Recombinant Proteins
Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.
For Use With (Application)
- (2)
- (2,391)
- (1)
- (23,537)
- (5)
- (1)
- (1)
- (68)
- (547)
- (9,349)
- (23)
- (1)
- (7)
- (2)
- (13)
- (3)
- (4)
- (3)
- (1)
- (2)
- (4)
- (14)
- (70)
- (2)
- (2)
- (2)
- (1)
- (3)
- (2)
- (1)
- (157)
- (3)
- (4)
- (1)
- (1)
- (1)
- (3)
- (253)
- (26,478)
- (1)
- (1)
- (2)
- (1)
- (25)
- (36,443)
- (1,335)
- (2)
- (2)
- (32)
- (3)
- (787)
- (14)
- (2)
- (1)
- (8)
- (1)
- (5)
- (1)
- (123)
- (1)
- (144)
- (1,405)
- (3)
- (4)
- (7)
- (5)
- (1)
- (3)
- (1)
- (1)
- (1)
- (14)
- (11,447)
- (48)
- (6)
- (31)
- (16)
- (1)
- (10)
- (4)
- (110)
- (18)
- (2)
- (3)
- (119)
- (4)
- (148)
- (98)
- (19)
- (1)
- (1)
- (4)
- (1)
- (1,578)
- (2)
- (1)
- (160)
- (48)
- (11)
- (3)
- (1)
- (2)
- (9)
- (27)
- (2)
- (21,952)
- (2,939)
- (4)
- (1)
- (2)
- (114)
- (2,860)
- (4)
- (1)
- (1)
- (4)
- (1)
- (1)
- (3)
- (1)
- (34,931)
- (6)
- (3)
- (1)
- (1)
- (63)
- (6)
- (2)
- (7)
- (5)
- (1)
- (2)
- (6)
- (1)
- (1)
- (8,296)
- (6)
- (4)
- (4)
- (1)
- (3)
- (1)
- (3)
- (2)
- (14)
- (19)
- (1)
- (3)
- (3)
- (4)
- (36,975)
- (1,823)
- (1)
- (3)
Recombinant
- (285)
- (9)
- (66,416)
- (1)
Form
- (15)
- (1)
- (2)
- (45,198)
- (10,339)
- (245)
- (168)
- (56)
- (3,358)
Species
- (2)
- (1)
- (2)
- (1)
- (90)
- (557)
- (96)
- (2)
- (1)
- (1)
- (2)
- (1)
- (27)
- (5)
- (8)
- (15)
- (1)
- (72)
- (1)
- (1,302)
- (1)
- (3)
- (16)
- (1)
- (3)
- (1)
- (1)
- (1)
- (8)
- (1)
- (4)
- (1)
- (1)
- (29,100)
- (5)
- (22)
- (8)
- (4)
- (1,290)
- (2)
- (1)
- (1)
- (3)
- (1)
- (1)
- (8)
- (14)
- (32)
- (24)
- (1)
- (2)
- (16)
- (233)
- (9)
- (2)
- (5)
- (1)
- (2)
- (2)
- (2)
- (23)
- (5)
- (3)
- (3)
- (2)
- (14)
- (23,572)
- (1)
- (44)
Regulatory Status
- (79)
- (54,649)
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
Search Within Results
Keyword Search:
Clear All
3,886
–
3,900
of
129,858
results
Novus Biologicals™ UAP56 Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Regulatory Status | RUO |
|---|---|
| Purification Method | Protein |
| Purity or Quality Grade | >90% |
| Conjugate | Unconjugated |
| Common Name | UAP56 |
| Molecular Weight (g/mol) | 51.1kDa |
| Gene ID (Entrez) | 7919 |
| Formulation | Liquid. 20mM Tris-HCl buffer (pH 8.0) containing 20% glycerol 0.1M NaCl, 1mM DTT |
| Immunogen | BAT1, 1-428 aa. Sequence: MGSSHHHHHHSSGLVPRGSHMAENDVDNELLDYEDDEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQTR |
| Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
| Concentration | 0.5mg/mL |
| For Use With (Application) | ELISA,SDS-PAGE |
| Source | Human |
Invitrogen™ Human UCKL1 (aa 412-541) Control Fragment Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Invitrogen™ Human PIGR (aa 201-329) Control Fragment Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Invitrogen™ Human TENM1 (aa 32-108) Control Fragment Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Invitrogen™ Human PLXNA3 (aa 958-1040) Control Fragment Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Invitrogen™ Human TGIF (aa 294-358) Control Fragment Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Invitrogen™ Human ZNF596 (aa 43-110) Control Fragment Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Invitrogen™ Human NCK2 (aa 210-290) Control Fragment Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Invitrogen™ Human Filamin B (aa 1145-1253) Control Fragment Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Invitrogen™ Human Talin 1 (aa 1775-1879) Control Fragment Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Invitrogen™ Human NRAP (aa 419-506) Control Fragment Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Invitrogen™ Human ME1 (aa 286-415) Control Fragment Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Invitrogen™ Human ACAA2 (aa 3-149) Control Fragment Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Invitrogen™ Human C14orf130 (aa 10-148) Control Fragment Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Invitrogen™ Human NRIP3 (aa 121-200) Control Fragment Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More