Invitrogen™ Human PIGR (aa 201-329) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP88784	100 μL

Catalog No. RP88784 Supplier Invitrogen™ Supplier No. RP88784

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110769. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Polymeric IgA and IgM is produced and secreted by B cells in the lamina propria, which is beneath the mucosal lining of polarized epithelial cells. Polymeric immunoglobulin receptors, also designated pIgRs, are expressed on the basolateral surface of glandular epithelia and mediate transcellular transport of secretory immunoglobulin polymers across the epithelium. pIgR associates with secreted dimeric IgA and IgM molecules. During transcellular transport of these Ig polymers, pIgR undergoes proteolytic cleavage to generate a fragment called secretory component (SC), polymeric immunoglobulin receptor or poly-IG receptor. When immunoglobulin polymers associate with SC, they become resistant to enzymatic degradation during the transcytosis process. SC and the pIgR are crucial for proper mucosal immunity where they represent a molecular chaperone for polymeric Igs to remain intact and enter into body fluids. The human SC (pIgR) gene maps to chromosome 1q31-q41 and encodes a 764 amino acid protein. The receptor contains five units with homology to the variable (V) units of immunoglobulins and a transmembrane region that shares homology to certain immunoglobulin variable regions.

Specifications

• Accession Number: P01833
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5284
• Name: Human PIGR (aa 201-329) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: hepatocellular carcinoma associated protein TB6; hepatocellular carcinoma-associated protein TB6; phosphatidylinositol glycan, class R; Pigr; Poly Ig receptor; poly-Ig receptor; polymeric immunoglobulin receptor; Secretory component; tb6
• Common Name: PIGR
• Gene Symbol: Pigr
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LLFSVVINQLRLSDAGQYLCQAGDDSNSNKKNADLQVLKPEPELVYEDLRGSVTFHCALGPEVANVAKFLCRQSSGENCDVVVNTLGKRAPAFEGRILLNPQDKDGSFSVVITGLRKEDAGRYLCGAHS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining