Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

3,931 – 3,945 of 115,741 results

3,931

R&D Systems™ Recombinant Mouse SCARA5 Protein

Extensive quality control produces lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

3,932

R&D Systems™ Recombinant Mouse Ephrin-A2 Fc Chimera Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

3,933

Novus Biologicals™ CCS/SOD4 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	Protein
Purity or Quality Grade	>90%
Conjugate	Unconjugated
Common Name	CCS/SOD4
Molecular Weight (g/mol)	31.2kDa
Gene ID (Entrez)	9973
Formulation	Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.2M NaCl 1mM DTT, 10% glycerol
Immunogen	CCS, 1-274 aa. Sequence: MGSSHHHHHHSSGLVPRGSHMASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIRSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	1mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Human

3,934

Novus Biologicals™ Recombinant Human NEIL2 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

3,935

Novus Biologicals™ Tau Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	SDS-PAGE
Purity or Quality Grade	>80%
Conjugate	Unconjugated
Common Name	Tau
Molecular Weight (g/mol)	45.1kDa
Formulation	Liquid. 20mM Tris-HCl buffer (pH 8.0) containing 20% glycerol
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	SDS-PAGE

3,936

Novus Biologicals™ DNAJB8 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

3,937

Novus Biologicals™ Recombinant Human GAPDH Protein

Highly purified and high bioactivity. Generating reliable and reproducible results.

Pricing & Availability

3,938

Novus Biologicals™ SDSL Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

3,939

R&D Systems™ Recombinant Mouse EGFLAM Flag-tag Protein

Measured by its binding ability in a functional ELISA.

Pricing & Availability

3,940

R&D Systems™ Recombinant Human Fc epsilon RI alpha Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

3,941

Novus Biologicals™ Recombinant Human NAIF1 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Purity or Quality Grade	>90%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain
Conjugate	Unconjugated
Gene Alias	bA379C10.2, C9orf90RP11-379C10.2, chromosome 9 open reading frame 90, DKFZp762G199, nuclear apoptosis inducing factor 1, nuclear apoptosis-inducing factor 1
Common Name	NAIF1
Molecular Weight (g/mol)	TMW: 37.6kDa
Gene ID (Entrez)	203245
Formulation	20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 30% glycerol, 1mM DTT
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	0.25mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

3,942

R&D Systems™ Recombinant Human mGluR2 Protein

R&D Systems™ Recombinant HumanmgluR2 Protein CF are coupled to effector systems through GTP-binding proteins and modulate glutamate neurotransmission in the central and peripheral nervous systems.

Pricing & Availability

3,943

Novus Biologicals™ Proteasome 20S alpha 2 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

3,944

R&D Systems™ Recombinant SARS-CoV Spike S1 Subunit Fc Chimera Protein

CHO Expressed

Pricing & Availability

3,945

Novus Biologicals™ RGS21 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	SDS-PAGE
Purity or Quality Grade	>90%
Conjugate	Unconjugated
Common Name	RGS21
Storage Requirements	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
For Use With (Application)	SDS-PAGE
Source	Human

Prev
1
...
261
262
263
264
...
7,717
Next

Welcome to fishersci.com

Recombinant Proteins

Filtered Search Results

Narrow Results

Novus Biologicals™ CCS/SOD4 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human NEIL2 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Tau Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ DNAJB8 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human GAPDH Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ SDSL Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human NAIF1 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Proteasome 20S alpha 2 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ RGS21 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ CCS/SOD4 Protein

Novus Biologicals™ Recombinant Human NEIL2 His Protein

Novus Biologicals™ Tau Protein

Novus Biologicals™ DNAJB8 Protein

Novus Biologicals™ Recombinant Human GAPDH Protein

Novus Biologicals™ SDSL Protein

Novus Biologicals™ Recombinant Human NAIF1 His Protein

Novus Biologicals™ Proteasome 20S alpha 2 Protein

Novus Biologicals™ RGS21 Protein