Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ CCS/SOD4 Protein

Highly purified. Generating reliable and reproducible results.

Manufacturer:  Novus Biologicals™ NBP1483930.5MG

 View more versions of this product

Catalog No. NBP1483935


Add to cart

Description

Description

A recombinant protein with a N-Terminal His-tag and corresponding to the amino acids 1-274 of Human CCS/SOD4 The Recombinant Human CCS/SOD4 Protein is derived from E. coli. The Recombinant Human CCS/SOD4 Protein has been validated for the following applications: SDS-Page.
Specifications

Specifications

1mg/mL
Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.2M NaCl 1mM DTT, 10% glycerol
31.2kDa
>90%
Human
Store at -80°C. Avoid freeze-thaw cycles.
CCS/SOD4
ELISA, SDS-Page
9973
Protein
0.5mg
CCS, 1-274 aa. Sequence: MGSSHHHHHHSSGLVPRGSHMASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIRSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL
RUO
Unlabeled
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit