Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ CCS/SOD4 Protein
SDP

Catalog No. NBP1483935 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mg
0.5 mg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP1483935 0.5 mg
NBP14839301 0.1 mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP1483935 Supplier Novus Biologicals™ Supplier No. NBP1483930.5MG
Add to Cart
Add to Cart

Highly purified. Generating reliable and reproducible results.

A recombinant protein with a N-Terminal His-tag and corresponding to the amino acids 1-274 of Human CCS/SOD4 The Recombinant Human CCS/SOD4 Protein is derived from E. coli. The Recombinant Human CCS/SOD4 Protein has been validated for the following applications: SDS-Page.

Specifications

Concentration 1mg/mL
For Use With (Application) ELISA, SDS-PAGE
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.2M NaCl 1mM DTT, 10% glycerol
Gene ID (Entrez) 9973
Molecular Weight (g/mol) 31.2kDa
Purification Method Protein
Quantity 0.5 mg
Source Human
Immunogen CCS, 1-274 aa. Sequence: MGSSHHHHHHSSGLVPRGSHMASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIRSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL
Storage Requirements Store at -80°C. Avoid freeze-thaw cycles.
Regulatory Status RUO
Common Name CCS/SOD4
Conjugate Unconjugated
Purity or Quality Grade >90%
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.