Recombinant Proteins
- (2)
- (970)
- (1)
- (23,543)
- (5)
- (1)
- (1)
- (67)
- (219)
- (4,424)
- (23)
- (1)
- (4)
- (2)
- (13)
- (21,461)
- (3)
- (4)
- (3)
- (1)
- (2)
- (4)
- (14)
- (71)
- (2)
- (2)
- (2)
- (1)
- (3)
- (2)
- (1)
- (3)
- (4)
- (1)
- (1)
- (1)
- (3)
- (254)
- (22,606)
- (1)
- (1)
- (2)
- (1)
- (13)
- (26,166)
- (256)
- (32)
- (3)
- (708)
- (14)
- (2)
- (1)
- (8)
- (1)
- (5)
- (1)
- (108)
- (1)
- (3,782)
- (1,408)
- (3)
- (4)
- (2)
- (5)
- (1)
- (1)
- (1)
- (1)
- (14)
- (138)
- (48)
- (6)
- (17)
- (2)
- (1)
- (4)
- (81)
- (12)
- (2)
- (3)
- (80)
- (4)
- (113)
- (96)
- (19)
- (1)
- (1)
- (4)
- (1)
- (1,522)
- (2)
- (1)
- (3)
- (18)
- (48)
- (3)
- (1)
- (2)
- (9)
- (27)
- (2)
- (191)
- (1)
- (4)
- (1)
- (2)
- (114)
- (44)
- (2)
- (1)
- (1)
- (4)
- (1)
- (1)
- (3)
- (1)
- (23,710)
- (6)
- (3)
- (1)
- (1)
- (63)
- (6)
- (2)
- (7)
- (5)
- (1)
- (2)
- (1)
- (1)
- (6,728)
- (6)
- (4)
- (1)
- (3)
- (1)
- (3)
- (2)
- (13)
- (17)
- (1)
- (3)
- (3)
- (4)
- (25,926)
- (240)
- (1)
- (3)
- (286)
- (2)
- (61,741)
- (1)
- (15)
- (1)
- (2)
- (45,213)
- (5,693)
- (245)
- (168)
- (56)
- (3,364)
- (2)
- (1)
- (2)
- (1)
- (21)
- (558)
- (96)
- (2)
- (1)
- (1)
- (2)
- (1)
- (27)
- (1)
- (8)
- (15)
- (1)
- (72)
- (1)
- (1,042)
- (1)
- (3)
- (16)
- (1)
- (3)
- (1)
- (1)
- (1)
- (8)
- (1)
- (4)
- (1)
- (1)
- (26,017)
- (5)
- (1)
- (4)
- (582)
- (2)
- (1)
- (1)
- (3)
- (1)
- (1)
- (14)
- (32)
- (24)
- (1)
- (2)
- (16)
- (120)
- (9)
- (2)
- (1)
- (2)
- (2)
- (2)
- (23)
- (5)
- (3)
- (3)
- (2)
- (14)
- (23,574)
- (1)
- (48)
- (7)
- (1)
- (3)
- (18)
- (2)
- (62)
- (1)
- (4)
- (2)
- (9)
- (59)
- (1)
- (2)
- (3)
- (1)
- (391)
- (1)
- (3)
- (2)
- (1)
- (1)
- (1)
- (3)
- (2)
- (6)
- (19)
- (7)
- (2)
- (2)
- (3)
- (45)
- (1)
- (1)
- (1)
- (2)
- (5)
- (1)
- (1)
- (1)
- (1)
- (2)
- (8)
- (2)
- (3)
- (38,945)
- (1)
- (11)
Filtered Search Results
Novus Biologicals™ Recombinant Human Kallikrein 10 His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results. Applications: SDS-Page
| Purity or Quality Grade | >85%, by SDS-PAGE |
|---|---|
| Conjugate | Unconjugated |
| Gene Alias | breast normal epithelial cell associated serine protease, EC 3.4.21, EC 3.4.21.-, EC 3.4.21.74, Kallikrein 10, kallikrein-related peptidase 10, NES1kallikrein-10, Normal epithelial cell-specific 1, Protease serine-like 1, PRSSL1protease, serine-like, 1 |
| Common Name | Kallikrein 10 |
| Molecular Weight (g/mol) | TMW: 29.1kDa |
| Gene ID (Entrez) | 5655 |
| Formulation | 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol 0.4M UREA |
| Storage Requirements | Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles. |
| Concentration | 1mg/mL |
| For Use With (Application) | SDS-PAGE |
| Recombinant | Recombinant |
Novus Biologicals™ LSM3 Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Regulatory Status | RUO |
|---|---|
| Purification Method | SDS-PAGE |
| Purity or Quality Grade | >90% |
| Conjugate | Unconjugated |
| Common Name | LSM3 |
| Storage Requirements | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| For Use With (Application) | SDS-PAGE |
| Source | Human |
Novus Biologicals™ RAB2B Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Regulatory Status | RUO |
|---|---|
| Purification Method | SDS-PAGE |
| Purity or Quality Grade | >95% |
| Conjugate | Unconjugated |
| Common Name | RAB2B |
| Storage Requirements | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| For Use With (Application) | SDS-PAGE |
| Source | Human |
Novus Biologicals™ RTN4IP1 Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Regulatory Status | RUO |
|---|---|
| Purification Method | SDS-PAGE |
| Purity or Quality Grade | >95% |
| Conjugate | Unconjugated |
| Common Name | RTN4IP1 |
| Storage Requirements | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| For Use With (Application) | SDS-PAGE |
| Source | Human |
Novus Biologicals™ HDGFRP3 Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Regulatory Status | RUO |
|---|---|
| Purification Method | SDS-PAGE |
| Purity or Quality Grade | >90% |
| Conjugate | Unconjugated |
| Common Name | HDGFRP3 |
| Storage Requirements | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| For Use With (Application) | SDS-PAGE |
| Source | Human |
Novus Biologicals™ Recombinant Human Serine racemase His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
Novus Biologicals™ Recombinant Human PSMB10/MECL1 His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
Novus Biologicals™ Nanog Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
Novus Biologicals™ ANP32A Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Regulatory Status | RUO |
|---|---|
| Purification Method | Protein |
| Purity or Quality Grade | >90% |
| Conjugate | Unconjugated |
| Common Name | ANP32A |
| Molecular Weight (g/mol) | 30.7kDa |
| Gene ID (Entrez) | 8125 |
| Formulation | Liquid. 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 1mM DTT, 100mM NaCl, 0.1mM PMSF |
| Immunogen | ANP32A, 1-249aa. Sequence: MGSSHHHHHHSSGLVPRGSHMEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD |
| Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
| Concentration | 0.5mg/mL |
| For Use With (Application) | ELISA,SDS-PAGE |
| Source | Human |
R&D Systems™ Recombinant Cynomolgus OX40/TNFRSF4 His-tag Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity
Novus Biologicals™ Recombinant Human CD47 hIgG-His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results. Applications: SDS-Page
| Purity or Quality Grade | >95%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain |
|---|---|
| Conjugate | Unconjugated |
| Gene Alias | antigen identified by monoclonal 1D8, Antigenic surface determinant protein OA3, CD47 antigen, CD47 antigen (Rh-related antigen, integrin-associated signal transducer), CD47 glycoprotein, CD47 molecule, IAPintegrin associated protein, Integrin-associated protein, leukocyte surface antigen CD47, MER6integrin-associated signal transducer, OA3, Protein MER6, Rh-related antigen |
| Common Name | CD47 |
| Molecular Weight (g/mol) | TMW: 40.9kDa |
| Gene ID (Entrez) | 961 |
| Formulation | Phosphate buffered saline (pH 7.4) containing 10% glycerol |
| Storage Requirements | Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles. |
| Concentration | 0.5mg/mL |
| For Use With (Application) | SDS-PAGE |
| Source | Baculovirus |
| Recombinant | Recombinant |
Novus Biologicals™ MLC1SA Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
Invitrogen™ Human TBK1, GST Tag Recombinant Protein
Recombinant Protein
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Conjugate | Unconjugated |
|---|---|
| Form | Liquid |
| Common Name | TBK1 |
| Molecular Weight (g/mol) | 109.9 kDa |
| KinaseFamily | CK1 Kinase Family |
| Sequence | Full length |
| Concentration | See Label |
| Expression System | Insect cells |
| For Use With (Application) | Kinase Assay |
| Name | Human TBK1, GST Tag |
| Accession Number | Q9UHD2 |
| Gene Alias | 1200008B05Rik; AI462036; AW048562; FLJ11330; FTDALS4; NAK; NF-kappa-B-activating kinase; NF-kB-activating kinase; serine/threonine protein kinase TBK1; serine/threonine-protein kinase TBK1; T2K; TANK binding kinase 1; TANK-binding kinase 1; tbk; TBK1 |
| Gene ID (Entrez) | 29110 |
| Protein Tag | GST-tag |
| Species | Human |
| Recombinant | Recombinant |