Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ ANP32A Protein

Highly purified. Generating reliable and reproducible results.

Manufacturer:  Novus Biologicals™ NBP1483900.25MG

 View more versions of this product

Catalog No. NBP14839025


Add to cart

Description

Description

A recombinant protein with a N-Terminal His-tag and corresponding to the amino acids 1-249 of Human ANP32A The Recombinant Human ANP32A Protein is derived from E. coli. The Recombinant Human ANP32A Protein has been validated for the following applications: SDS-Page.
Specifications

Specifications

0.5mg/mL
Liquid. 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 1mM DTT, 100mM NaCl, 0.1mM PMSF
30.7kDa
>90%
Human
Store at -80°C. Avoid freeze-thaw cycles.
ANP32A
ELISA, SDS-Page
8125
Protein
0.25mg
ANP32A, 1-249aa. Sequence: MGSSHHHHHHSSGLVPRGSHMEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD
RUO
Unlabeled
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit