Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

Search Within Results

5,806 – 5,820 of 129,857 results

5,806

Novus Biologicals™ Recombinant Human OXER1/5-oxo-ETE GPCR Protein

Recombinant Protein

Pricing & Availability

5,807

Novus Biologicals™ Recombinant Human XRCC2 GST (N-Term) Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Gene Alias	DKFZp781P0919, DNA repair protein XRCC2, X-ray repair complementing defective repair in Chinese hamster cells 2, X-ray repair cross-complementing protein 2, X-ray repair, complementing defective, repair in Chinese hamster
Molecular Weight (g/mol)	56.54 kDa
Gene ID (Entrez)	7516
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Gene Symbol	XRCC2
Research Category	Breast Cancer, Cancer, DNA Repair, Homologous Recombination, Tumor Suppressors
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
For Use With (Application)	Western Blot,ELISA,Protein Array,Immunoaffinity Purification
Protein	XRCC2

5,808

Novus Biologicals™ Recombinant Human Syntaxin-BP1 GST (N-Term) Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Gene Alias	EIEE4, FLJ37475, hUNC18, MUNC18-1, N-Sec1, NSEC1, P67, Protein unc-18 homolog 1, Protein unc-18 homolog A, RBSEC1, syntaxin binding protein 1, syntaxin-binding protein 1, Unc18-1, unc-18A, UNC18A, UNC18neuronal SEC1
Molecular Weight (g/mol)	36.19 kDa
Gene ID (Entrez)	6812
Formulation	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Gene Symbol	STXBP1
Research Category	Phospho Specific
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
For Use With (Application)	Western Blot,ELISA,Protein Array,Immunoaffinity Purification
Protein	Syntaxin-BP1

5,809

Novus Biologicals™ Recombinant Human Gastrokine 2 GST (N-Term) Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Gene Alias	BlblDown-regulated in gastric cancer, BLOT, down regulated in gastric cancer GDDR, gastrokine 2, GDDRdown-regulated in gastric cancer GDDR, PRO813, TFIZ1gastrokine-2, Trefoil factor interactions(z) 1, VLTI465
Molecular Weight (g/mol)	MolecularWeight-theroretical: 46.9 kDa
Gene ID (Entrez)	200504
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Gene Symbol	GKN2
Storage Requirements	Store at -80°C. Avoid freeze/thaw cycles.
For Use With (Application)	Western Blot,ELISA,Protein Array,Immunoaffinity Purification
Protein	Gastrokine 2

5,810

Novus Biologicals™ Recombinant Human KRTAP17-1 GST (N-Term) Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Gene Alias	KAP17.1, keratin associated protein 16.1, keratin associated protein 17-1, keratin-associated protein 16.1, KRTAP16.1, KRTAP17.1
Molecular Weight (g/mol)	MolecularWeight-theroretical: 38.5 kDa
Gene ID (Entrez)	83902
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Gene Symbol	KRTAP17-1
Storage Requirements	Store at -80°C. Avoid freeze/thaw cycles.
For Use With (Application)	Western Blot,ELISA,Protein Array,Immunoaffinity Purification
Protein	KRTAP17-1

5,811

Novus Biologicals™ Recombinant Human ENTPD8 GST (N-Term) Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Gene Alias	EC 3.6.1, EC 3.6.1.5, ecto-ATP-diphosphohydrolase, ectonucleoside triphosphate diphosphohydrolase 8, E-NTPDase 8, GLSR2492, liver ecto-ATP-diphosphohydrolase, NTPDase 8, NTPDase8, NTPDase-8, nucleoside triphosphate diphosphohydrolase-8, UNQ2492
Molecular Weight (g/mol)	MolecularWeight-theroretical: 77.33 kDa
Gene ID (Entrez)	377841
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Gene Symbol	ENTPD8
Storage Requirements	Store at -80°C. Avoid freeze/thaw cycles.
For Use With (Application)	Western Blot,ELISA,Protein Array,Immunoaffinity Purification
Protein	ENTPD8

5,812

Novus Biologicals™ Recombinant Human C5orf4 GST (N-Term) Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Gene Alias	chromosome 5 open reading frame 4, FLJ13758, hypothetical protein LOC10826
Molecular Weight (g/mol)	49.2 kDa
Gene ID (Entrez)	10826
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Gene Symbol	C5ORF4
Research Category	Lipid and Metabolism
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
For Use With (Application)	Western Blot,ELISA,Protein Array,Immunoaffinity Purification
Protein	C5orf4

5,813

MilliporeSigma™ Upstate™ Human Recombinant Histone H2A.X Protein

Pricing & Availability

5,814

Novus Biologicals™ FKBP14 Protein

Highly purified and high bioactivity. Generating reliable and reproducible results. Applications: Functional, SDS-Page, Bioactivity

Pricing & Availability
Specifications

Purity or Quality Grade	>90%
Conjugate	Unconjugated
Common Name	FKBP14
Molecular Weight (g/mol)	24.2kDa
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	1.0mg/mL
For Use With (Application)	ELISA,Functional Assay,SDS-PAGE
Source	Human
Regulatory Status	RUO
Purification Method	Protein
Gene ID (Entrez)	55033
Formulation	Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Immunogen	MGSSHHHHHH SSGLVPRGSH MALIPEPEVK IEVLQKPFIC HRKTKGGDLM LVHYEGYLEK DGSLFHSTHK HNNGQPIWFT LGILEALKGW DQGLKGMCVG EKRKLIIPPA LGYGKEGKGK IPPESTLIFN IDLLEIRNGP RSHESFQEMD LNDDWKLSKD EVKAYLKKEF EKHGAVVNES HHDALVEDIF DKEDEDKDGF ISAREFTYKH DEL
Recombinant	Recombinant

5,815

R&D Systems™ Recombinant Mouse L-Selectin/CD62L His-tag Protein

The Recombinant Mouse L-Selectin/CD62L His-tag Protein is derived from NS0

Pricing & Availability

5,816

Invitrogen™ Human NEK7, His Tag Recombinant Protein

Recombinant Protein

Pricing & Availability

5,817

Novus Biologicals™ BPHL Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	SDS-PAGE
Purity or Quality Grade	>95%
Conjugate	Unconjugated
Common Name	BPHL
Molecular Weight (g/mol)	31.1kDa
Formulation	Liquid. 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 1mM DTT, 50mM NaCl
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	SDS-PAGE

5,818

Novus Biologicals™ ANP32A Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	Protein
Purity or Quality Grade	>90%
Conjugate	Unconjugated
Common Name	ANP32A
Molecular Weight (g/mol)	30.7kDa
Gene ID (Entrez)	8125
Formulation	Liquid. 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 1mM DTT, 100mM NaCl, 0.1mM PMSF
Immunogen	ANP32A, 1-249aa. Sequence: MGSSHHHHHHSSGLVPRGSHMEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Human

5,819

Promotions Available

R&DSystems™ Recombinant Human TSPAN31-LEL Fc Chimera Protein, CF

Recombinant Protein

Pricing & Availability

5,820

R&D Systems™ Recombinant Zebrafish BMP-2a Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability
Specifications

Purity or Quality Grade	97%, by SDS-PAGE under reducing conditions and visualized by silver stain.
Conjugate	Unconjugated
Molecular Weight (g/mol)	13 kDa (monomer)
Gene ID (Entrez)	30631
Quantity	10 μg
Structural Form	Disulfide-linked homodimer
Storage Requirements	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution.
Source	E. coli-derived zebrafish BMP-2a protein Gln272-Arg386,with an N-terminal Met
Recombinant	Recombinant
Name	BMP-2a

Recombinant Proteins

Filtered Search Results

Narrow Results

Novus Biologicals™ Recombinant Human OXER1/5-oxo-ETE GPCR Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human XRCC2 GST (N-Term) Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human Syntaxin-BP1 GST (N-Term) Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human Gastrokine 2 GST (N-Term) Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human KRTAP17-1 GST (N-Term) Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human ENTPD8 GST (N-Term) Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human C5orf4 GST (N-Term) Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ FKBP14 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

R&D Systems™ Recombinant Mouse L-Selectin/CD62L His-tag Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ BPHL Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ ANP32A Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

R&DSystems™ Recombinant Human TSPAN31-LEL Fc Chimera Protein, CF Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

R&D Systems™ Recombinant Zebrafish BMP-2a Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human OXER1/5-oxo-ETE GPCR Protein

Novus Biologicals™ Recombinant Human XRCC2 GST (N-Term) Protein

Novus Biologicals™ Recombinant Human Syntaxin-BP1 GST (N-Term) Protein

Novus Biologicals™ Recombinant Human Gastrokine 2 GST (N-Term) Protein

Novus Biologicals™ Recombinant Human KRTAP17-1 GST (N-Term) Protein

Novus Biologicals™ Recombinant Human ENTPD8 GST (N-Term) Protein

Novus Biologicals™ Recombinant Human C5orf4 GST (N-Term) Protein

Novus Biologicals™ FKBP14 Protein

R&D Systems™ Recombinant Mouse L-Selectin/CD62L His-tag Protein

Novus Biologicals™ BPHL Protein

Novus Biologicals™ ANP32A Protein

R&DSystems™ Recombinant Human TSPAN31-LEL Fc Chimera Protein, CF

R&D Systems™ Recombinant Zebrafish BMP-2a Protein