Recombinant Proteins
- (2)
- (2,391)
- (1)
- (23,537)
- (5)
- (1)
- (1)
- (68)
- (547)
- (9,349)
- (23)
- (1)
- (7)
- (2)
- (13)
- (3)
- (4)
- (3)
- (1)
- (2)
- (4)
- (14)
- (70)
- (2)
- (2)
- (2)
- (1)
- (3)
- (2)
- (1)
- (157)
- (3)
- (4)
- (1)
- (1)
- (1)
- (3)
- (253)
- (26,478)
- (1)
- (1)
- (2)
- (1)
- (25)
- (36,443)
- (1,335)
- (2)
- (2)
- (32)
- (3)
- (787)
- (14)
- (2)
- (1)
- (8)
- (1)
- (5)
- (1)
- (123)
- (1)
- (144)
- (1,405)
- (3)
- (4)
- (7)
- (5)
- (1)
- (3)
- (1)
- (1)
- (1)
- (14)
- (11,447)
- (48)
- (6)
- (31)
- (16)
- (1)
- (10)
- (4)
- (110)
- (18)
- (2)
- (3)
- (119)
- (4)
- (148)
- (98)
- (19)
- (1)
- (1)
- (4)
- (1)
- (1,578)
- (2)
- (1)
- (160)
- (48)
- (11)
- (3)
- (1)
- (2)
- (9)
- (27)
- (2)
- (21,952)
- (2,939)
- (4)
- (1)
- (2)
- (114)
- (2,860)
- (4)
- (1)
- (1)
- (4)
- (1)
- (1)
- (3)
- (1)
- (34,931)
- (6)
- (3)
- (1)
- (1)
- (63)
- (6)
- (2)
- (7)
- (5)
- (1)
- (2)
- (6)
- (1)
- (1)
- (8,296)
- (6)
- (4)
- (4)
- (1)
- (3)
- (1)
- (3)
- (2)
- (14)
- (19)
- (1)
- (3)
- (3)
- (4)
- (36,975)
- (1,823)
- (1)
- (3)
- (285)
- (9)
- (66,416)
- (1)
- (15)
- (1)
- (2)
- (45,198)
- (10,339)
- (245)
- (168)
- (56)
- (3,358)
- (2)
- (1)
- (2)
- (1)
- (90)
- (557)
- (96)
- (2)
- (1)
- (1)
- (2)
- (1)
- (27)
- (5)
- (8)
- (15)
- (1)
- (72)
- (1)
- (1,302)
- (1)
- (3)
- (16)
- (1)
- (3)
- (1)
- (1)
- (1)
- (8)
- (1)
- (4)
- (1)
- (1)
- (29,100)
- (5)
- (22)
- (8)
- (4)
- (1,290)
- (2)
- (1)
- (1)
- (3)
- (1)
- (1)
- (8)
- (14)
- (32)
- (24)
- (1)
- (2)
- (16)
- (233)
- (9)
- (2)
- (5)
- (1)
- (2)
- (2)
- (2)
- (23)
- (5)
- (3)
- (3)
- (2)
- (14)
- (23,572)
- (1)
- (44)
- (79)
- (54,649)
Filtered Search Results
Novus Biologicals™ ATP5O Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Regulatory Status | RUO |
|---|---|
| Purification Method | SDS-PAGE |
| Purity or Quality Grade | >95% |
| Conjugate | Unconjugated |
| Common Name | ATP5O |
| Molecular Weight (g/mol) | 23.1kDa |
| Formulation | Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 40% glycerol, 0.2M NaCl |
| Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
| Concentration | 1mg/mL |
| For Use With (Application) | SDS-PAGE |
R&D Systems™ Recombinant Human Pleiotrophin/PTN Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity
| Purity or Quality Grade | 97%, by SDS-PAGE under reducing conditions and visualized by silver stain. |
|---|---|
| Conjugate | Unconjugated |
| Molecular Weight (g/mol) | 15.3 kDa |
| Gene ID (Entrez) | 5764 |
| Formulation | Lyophilized from a 0.2μm filtered solution in PBS. |
| Storage Requirements | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution. |
| Source | Spodoptera frugiperda,Sf 21 (baculovirus)-derived human Pleiotrophin/PTN protein Gly33-Asp168 |
| Recombinant | Recombinant |
| Name | Pleiotrophin/PTN |
Novus Biologicals™ CMBL Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Regulatory Status | RUO |
|---|---|
| Purification Method | SDS-PAGE |
| Purity or Quality Grade | >95% |
| Conjugate | Unconjugated |
| Common Name | CMBL |
| Storage Requirements | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| For Use With (Application) | SDS-PAGE |
| Source | Human |
Novus Biologicals™ Recombinant Human GARS His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Purity or Quality Grade | >85%, by SDS-PAGE |
|---|---|
| Conjugate | Unconjugated |
| Gene Alias | AP-4-A synthetase, Charcot-Marie-Tooth neuropathy 2D, Charcot-Marie-Tooth neuropathy, neuronal type, D, Diadenosine tetraphosphate synthetase, DSMAV, glycine tRNA ligase, Glycine--tRNA ligase, glycyl-tRNA synthetase, GlyRSEC 6.1.1.14, HMN5, SMAD1CMT2D |
| Common Name | GARS |
| Molecular Weight (g/mol) | TMW: 30kDa |
| Gene ID (Entrez) | 2617 |
| Formulation | 20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 10% glycerol, 1mM DTT |
| Storage Requirements | Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles. |
| Concentration | 0.5mg/mL |
| For Use With (Application) | SDS-PAGE |
| Recombinant | Recombinant |
R&D Systems™ Recombinant Mouse GASP-1/WFIKKN2 Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.
R&D Systems™ Recombinant Human CEACAM-21 Fc Chimera Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.
Novus Biologicals™ WASF3/WAVE3 Recombinant Protein Antigen
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Recombinant Protein
R&D Systems™ Recombinant Rat sTNF RII/TNFRSF1B Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.
Novus Biologicals™ Recombinant Human Troponin I Type 1 (slow skeletal) His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results. Applications: SDS-Page
Novus Biologicals™ Recombinant Human IL-18 BPa/IL18BP His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results. Applications: SDS-Page
Novus Biologicals™ ECHS1 Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Regulatory Status | RUO |
|---|---|
| Purification Method | Protein |
| Purity or Quality Grade | >95% |
| Conjugate | Unconjugated |
| Common Name | ECHS1 |
| Molecular Weight (g/mol) | 30.6kDa |
| Formulation | Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 20% glycerol, 100mM NaCl |
| Immunogen | ECHS1, 28- 290 aa. Sequence: MGSSHHHHHHSSGLVPRGSHMASGANFEYIIAEKRGKNNTVGLIQLNRPKALNALCDGLIDELNQALKIFEEDPAVGAIVLTGGDKAFAAGADIKEMQNLSFQDCYSSKFLKHWDHLTQVKKPVIAAVNGYAFGGGCELAMMCDIIYAGEKAQFAQPEILIGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEKRKANFKDQ |
| Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
| Concentration | 1mg/mL |
| For Use With (Application) | ELISA,SDS-PAGE |
| Source | Human |
Novus Biologicals™ Recombinant Human CD68/SR-D1 Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results. Applications: SDS-Page
| Conjugate | Unconjugated |
|---|---|
| Molecular Weight (g/mol) | 32.6kDa |
| Gene Symbol | CD68 |
| Endotoxin Concentration | <1.0 EU per 1μg of protein (determined by LAL method) |
| Storage Requirements | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| For Use With (Application) | SDS-PAGE |
| Source | Baculovirus |
| Name | Human CD68/SR-D1 Protein |
| Regulatory Status | RUO |
| Purification Method | >95%, by PAGE |
| Gene Alias | CD68 antigenmacrophage antigen CD68, CD68 molecule, DKFZp686M18236, GP110, macrosialin, SCARD1, scavenger receptor class D, member 1 |
| Product Type | Recombinant Protein |
| Gene ID (Entrez) | 968 |
| Formulation | Phosphate Buffered Saline (pH 7.4) containing 10% glycerol |
| Cross Reactivity | Human |
| Recombinant | Recombinant |
R&D Systems™ Recombinant Human Siglec-10 Fc Chimera Avi-tag Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Biotinylated
Novus Biologicals™ RAP74 Recombinant Protein Antigen
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Recombinant Protein