Recombinant Proteins
- (2)
- (970)
- (1)
- (23,542)
- (5)
- (1)
- (1)
- (67)
- (218)
- (4,423)
- (23)
- (1)
- (4)
- (2)
- (13)
- (21,453)
- (3)
- (4)
- (3)
- (1)
- (2)
- (4)
- (14)
- (71)
- (2)
- (2)
- (2)
- (1)
- (3)
- (2)
- (1)
- (3)
- (4)
- (1)
- (1)
- (1)
- (3)
- (253)
- (22,601)
- (1)
- (1)
- (2)
- (1)
- (13)
- (26,157)
- (255)
- (32)
- (3)
- (708)
- (14)
- (2)
- (1)
- (8)
- (1)
- (5)
- (1)
- (108)
- (1)
- (3,765)
- (1,407)
- (3)
- (4)
- (5)
- (1)
- (1)
- (1)
- (1)
- (14)
- (138)
- (48)
- (6)
- (17)
- (2)
- (1)
- (4)
- (81)
- (12)
- (2)
- (3)
- (80)
- (4)
- (113)
- (96)
- (19)
- (1)
- (1)
- (4)
- (1)
- (1,522)
- (2)
- (1)
- (3)
- (18)
- (48)
- (3)
- (1)
- (2)
- (9)
- (27)
- (2)
- (198)
- (1)
- (4)
- (1)
- (2)
- (114)
- (44)
- (2)
- (1)
- (1)
- (4)
- (1)
- (1)
- (3)
- (1)
- (23,710)
- (6)
- (3)
- (1)
- (1)
- (63)
- (6)
- (2)
- (7)
- (5)
- (1)
- (2)
- (1)
- (1)
- (6,728)
- (6)
- (4)
- (1)
- (3)
- (1)
- (3)
- (2)
- (13)
- (17)
- (1)
- (3)
- (3)
- (4)
- (25,917)
- (240)
- (1)
- (3)
- (286)
- (2)
- (61,720)
- (1)
- (15)
- (1)
- (2)
- (45,213)
- (5,673)
- (245)
- (168)
- (56)
- (3,363)
- (2)
- (1)
- (2)
- (1)
- (21)
- (558)
- (96)
- (2)
- (1)
- (1)
- (2)
- (1)
- (27)
- (1)
- (8)
- (15)
- (1)
- (72)
- (1)
- (1,042)
- (1)
- (3)
- (16)
- (1)
- (3)
- (1)
- (1)
- (1)
- (8)
- (1)
- (4)
- (1)
- (1)
- (26,017)
- (5)
- (1)
- (4)
- (582)
- (2)
- (1)
- (1)
- (3)
- (1)
- (1)
- (14)
- (32)
- (24)
- (1)
- (2)
- (16)
- (120)
- (9)
- (2)
- (1)
- (2)
- (2)
- (2)
- (23)
- (5)
- (3)
- (3)
- (2)
- (14)
- (23,574)
- (1)
- (48)
- (7)
- (1)
- (3)
- (18)
- (2)
- (62)
- (1)
- (4)
- (2)
- (9)
- (59)
- (1)
- (2)
- (3)
- (1)
- (391)
- (1)
- (3)
- (2)
- (1)
- (1)
- (1)
- (3)
- (2)
- (6)
- (19)
- (7)
- (2)
- (2)
- (3)
- (45)
- (1)
- (1)
- (1)
- (2)
- (5)
- (1)
- (1)
- (1)
- (1)
- (2)
- (8)
- (2)
- (3)
- (38,925)
- (1)
- (11)
Filtered Search Results
Novus Biologicals™ Recombinant Mouse DDT Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >95%, by SDS-PAGE |
| Molecular Weight (g/mol) | 15.5 kDa |
| Gene ID (Entrez) | 1652 |
| Formulation | 20mM Tris-Hcl buffer (pH8.0) containing 10% glycerol |
| Gene Symbol | DDT |
| Storage Requirements | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Concentration | 1 mg/ml |
| Cross Reactivity | DDT |
| For Use With (Application) | SDS-PAGE |
| Species | Mouse |
| Source | E. coli |
Novus Biologicals™ Recombinant Human ALAD His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
Novus Biologicals™ Recombinant Human NKIRAS2 His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
R&D Systems™ Recombinant Human NMNAT-1 Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Enzyme Activity
R&D Systems™ Recombinant Mouse CD38 Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.
R&D Systems™ Recombinant Human Glypican 1 Protein
Extensive quality control produces lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Binding Activity
R&D Systems™ Recombinant Human Collagen XXIII alpha 1/COL23A1 Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.
Novus Biologicals™ Recombinant Human AKAP7 His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
Novus Biologicals™ THYN1 Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Regulatory Status | RUO |
|---|---|
| Purification Method | Protein |
| Purity or Quality Grade | >95% |
| Conjugate | Unconjugated |
| Common Name | THYN1 |
| Molecular Weight (g/mol) | 27.8kDa |
| Gene ID (Entrez) | 29087 |
| Formulation | 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 20% glycerol, 100mM NaCl |
| Immunogen | THYN1, 1- 225 aa. Sequence: MGSSHHHHHHSSGLVPRGSHMSRPRKRLAGTSGSDKGLSGKRTKTENSGEALAKVEDSNPQKTSATKNCLKNLSSHWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFYHSNCKEPGIAGLMKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPLKNMVLFTRQRLSIQPLTQEEFDFVLSLEEKEPS |
| Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
| Concentration | 0.5mg/mL |
| For Use With (Application) | ELISA,SDS-PAGE |
| Source | Human |
Novus Biologicals™ PPCDC Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Regulatory Status | RUO |
|---|---|
| Purification Method | Protein |
| Purity or Quality Grade | >95% |
| Conjugate | Unconjugated |
| Common Name | PPCDC |
| Molecular Weight (g/mol) | 24.6kDa |
| Gene ID (Entrez) | 60490 |
| Formulation | Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 1mM DTT, 0.1M NaCl. |
| Immunogen | PPCDC, 1-204 aa. Sequence: MGSSHHHHHHSSGLVPRGSHMEPKASCPAAAPLMERKFHVLVGVTGSVAALKLPLLVSKLLDIPGLEVAVVTTERAKHFYSPQDIPVTLYSDADEWEMWKSRSDPVLHIDLRRWADLLLVAPLDANTLGKVASGICDNLLTCVMRAWDRSKPLLFCPAMNTAMWEHPITAQQVDQLKAFGYVEIPCVAKKLVCGDEGLGAMAEVGTIVDKVKEVLFQHSGFQQS |
| Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
| Concentration | 1mg/mL |
| For Use With (Application) | ELISA,SDS-PAGE |
| Source | Human |
BD Recombinant Human Interleukin-8 (IL-8)
8 kD protein containing 72 amino acid residues and promotes neutrophil chemotaxis and degranulation
R&D Systems™ Recombinant Mouse Skint2/B7S3 Fc Chimera Protein
Measured by its ability to inhibit IL-2 secretion by mouse T cells in the presence of anti-CD3. The ED50 for this effect is 0.5 to 5.0 μg/mL.
Novus Biologicals™ Recombinant Human POLR2F His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Purity or Quality Grade | >95%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain |
|---|---|
| Conjugate | Unconjugated |
| Gene Alias | DNA-directed RNA polymerase II subunit F, DNA-directed RNA polymerases I, II, and III 14.4 kDa polypeptide, HRBP14.4, II, and III subunit RPABC2, polymerase (RNA) II (DNA directed) polypeptide F, RNA Polymerase II subunit 14.4 kD, RNA polymerases I, II, and III subunit ABC2, RPB6, RPB6 homolog |
| Common Name | POLR2F |
| Molecular Weight (g/mol) | TMW: 16.9kDa |
| Gene ID (Entrez) | 5435 |
| Formulation | 20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 20% glycerol, 1mM DTT |
| Storage Requirements | Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles. |
| Concentration | 1mg/mL |
| For Use With (Application) | SDS-PAGE |
| Recombinant | Recombinant |