Thiophenes
Organic heterocyclic compounds that consist of a five-membered ring with four carbon atoms, and one sulfur atom.
Quantity
- (1)
- (203)
- (18)
- (1)
- (3)
- (18)
- (4)
- (12)
- (9)
- (84)
- (3)
- (4)
- (4)
- (46)
- (175)
- (3)
- (6)
- (1)
- (7)
- (3)
- (2)
- (1)
- (1)
Molecular Weight (g/mol)
- (1)
- (1)
- (1)
- (7)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
- (2)
- (2)
- (3)
- (1)
- (8)
- (16)
- (1)
- (4)
- (4)
- (3)
- (1)
- (4)
- (2)
- (1)
- (5)
- (1)
- (4)
- (3)
- (2)
- (4)
- (1)
- (1)
- (1)
- (6)
- (5)
- (1)
- (1)
- (1)
- (3)
- (2)
- (1)
- (1)
- (2)
- (2)
- (1)
- (1)
- (2)
- (5)
- (1)
- (2)
- (2)
- (1)
- (2)
- (11)
- (2)
- (2)
- (1)
- (1)
- (5)
- (3)
- (1)
- (2)
- (5)
- (6)
- (1)
- (1)
- (2)
- (1)
- (1)
- (2)
- (1)
- (4)
- (1)
- (7)
- (1)
- (2)
- (5)
- (3)
- (1)
- (6)
- (3)
- (1)
- (1)
- (4)
- (1)
- (2)
- (2)
- (2)
- (5)
- (2)
- (1)
- (10)
- (4)
- (1)
- (2)
- (1)
- (4)
- (2)
- (3)
- (1)
- (1)
- (3)
- (2)
- (2)
- (2)
- (2)
- (2)
- (6)
- (1)
- (8)
- (2)
- (2)
- (3)
- (4)
- (4)
- (1)
- (1)
- (2)
- (3)
- (2)
- (3)
- (1)
- (5)
- (4)
- (1)
- (2)
- (1)
- (1)
- (5)
- (1)
- (2)
- (2)
- (7)
- (1)
- (1)
- (2)
- (2)
- (7)
- (2)
- (3)
- (2)
- (2)
- (3)
- (1)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (2)
- (1)
- (1)
- (3)
- (1)
- (1)
- (3)
- (2)
- (1)
- (1)
- (1)
- (2)
- (2)
- (5)
- (2)
- (1)
- (1)
- (1)
- (2)
- (2)
- (1)
- (1)
- (3)
- (1)
- (1)
- (1)
- (2)
- (2)
- (3)
- (1)
- (1)
- (4)
- (1)
- (1)
- (1)
- (2)
- (1)
- (2)
- (2)
- (1)
- (5)
- (9)
- (2)
- (1)
- (1)
- (2)
- (1)
- (1)
- (4)
- (2)
- (2)
- (1)
- (1)
- (1)
- (1)
- (4)
- (2)
- (3)
- (2)
- (1)
- (4)
- (1)
- (2)
- (1)
- (2)
- (2)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (3)
- (1)
- (2)
- (3)
- (1)
- (2)
- (1)
- (3)
- (1)
- (2)
- (2)
- (2)
- (3)
- (1)
- (1)
- (2)
- (1)
- (2)
- (6)
- (3)
- (1)
- (2)
- (3)
- (2)
- (1)
- (1)
- (2)
- (1)
- (1)
- (2)
- (5)
- (1)
- (1)
- (1)
- (1)
- (2)
- (2)
- (2)
- (1)
- (2)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
Percent Purity
- (2)
- (1)
- (1)
- (2)
- (10)
- (4)
- (5)
- (2)
- (2)
- (23)
- (6)
- (1)
- (1)
- (11)
- (47)
- (2)
- (33)
- (9)
- (1)
- (5)
- (1)
- (7)
- (1)
- (2)
- (1)
- (1)
- (2)
- (5)
- (48)
- (13)
- (188)
- (2)
- (71)
- (3)
- (36)
- (2)
Physical Form
- (5)
- (130)
- (1)
- (1)
- (2)
- (2)
- (65)
- (3)
- (2)
- (7)
- (14)
Boiling Point
- (5)
- (2)
- (3)
- (2)
- (2)
- (1)
- (2)
- (2)
- (1)
- (2)
- (2)
- (1)
- (3)
- (2)
- (1)
- (1)
- (5)
- (1)
- (2)
- (3)
- (1)
- (2)
- (1)
- (1)
- (2)
- (3)
- (3)
- (1)
- (2)
- (2)
- (2)
- (1)
- (3)
- (3)
- (4)
- (2)
- (1)
- (1)
- (1)
- (2)
- (2)
- (3)
- (3)
- (1)
- (3)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (1)
- (2)
- (3)
- (3)
- (2)
- (4)
- (1)
- (1)
- (1)
- (1)
- (2)
- (2)
- (3)
- (3)
- (1)
- (1)
- (1)
- (2)
- (1)
- (2)
- (1)
- (1)
- (1)
- (3)
- (1)
- (1)
- (1)
- (2)
- (1)
- (3)
- (2)
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
Search Within Results
Keyword Search:
Clear All
2,026
–
2,040
of
4,390
results
2,026
Aobchem 2-Bromo-4-phenylthiophene | ≥97% | CAS 10353-18-1 | C10H7BrS | 10g
2-Bromo-4-phenylthiophene | ≥97% | CAS 10353-18-1 | C10H7BrS | 10g
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
2,027
Aobchem 4-(Thiophen-2-yl)pyridine | 97% | CAS 21298-54-4 | C9H7NS | 250mg
4-(Thiophen-2-yl)pyridine | 97% | CAS 21298-54-4 | C9H7NS | 250mg
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
2,028
Aobchem 3-Chloro-6-methyl-2-(methylthio)phenol | 95% | CAS 2707663-92-9 | C8H9ClOS | 500mg
3-Chloro-6-methyl-2-(methylthio)phenol | 95% | CAS 2707663-92-9 | C8H9ClOS | 500mg
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
2,029
Aobchem 2-Amino-5-(4-chlorophenyl)-1 3 4-oxadiazole | 95% | CAS 33621-61-3 | C8H6ClN3O | 1g
2-Amino-5-(4-chlorophenyl)-1 3 4-oxadiazole | 95% | CAS 33621-61-3 | C8H6ClN3O | 1g
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
2,030
Aobchem 3-Fluoro-5-methyl-2-(methylthio)benzaldehyde | 97% | CAS 2090465-63-5 | C9H9FOS | 500mg
3-Fluoro-5-methyl-2-(methylthio)benzaldehyde | 97% | CAS 2090465-63-5 | C9H9FOS | 500mg
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
2,031
Aobchem 5-(2-Fluorophenyl)-2-thiophenecarboxylic acid | ≥95% | CAS 893733-09-0 | C11H7FO2S | 1g
5-(2-Fluorophenyl)-2-thiophenecarboxylic acid | ≥95% | CAS 893733-09-0 | C11H7FO2S | 1g
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
2,032
Aobchem 2-Fluoro-3-methyl-5-(methylthio)benzaldehyde | ≥97% | CAS 2734778-36-8 | C9H9FOS | 1g
2-Fluoro-3-methyl-5-(methylthio)benzaldehyde | ≥97% | CAS 2734778-36-8 | C9H9FOS | 1g
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
2,033
Aobchem (2-Bromo-6-chloro-4-(methylthio)phenyl)boronic acid | 95% | C7H7BBrClO2S | 250mg
(2-Bromo-6-chloro-4-(methylthio)phenyl)boronic acid | 95% | C7H7BBrClO2S | 250mg
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
2,034
Aobchem 1-(5-(Pyridin-2-yl)thiophen-2-yl)ethanol | 95% | C11H11NOS | 1g
1-(5-(Pyridin-2-yl)thiophen-2-yl)ethanol | 95% | C11H11NOS | 1g
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
2,035
Aobchem 2-(5-(Methylthio)thiophen-2-yl)pyridine | 95% | C10H9NS2 | 1g
2-(5-(Methylthio)thiophen-2-yl)pyridine | 95% | C10H9NS2 | 1g
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
2,036
Aobchem (5-Bromo-2-fluoro-3-(methylthio)phenyl)methanol | 97% | CAS 2764728-77-8 | C8H8BrFOS | 250mg
(5-Bromo-2-fluoro-3-(methylthio)phenyl)methanol | 97% | CAS 2764728-77-8 | C8H8BrFOS | 250mg
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
2,037
Aobchem Ethyl 3-hydroxy-3-(thiophen-2-yl)butanoate | 97% | CAS 857979-11-4 | C10H14O3S | 250mg
Ethyl 3-hydroxy-3-(thiophen-2-yl)butanoate | 97% | CAS 857979-11-4 | C10H14O3S | 250mg
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
2,038
Aobchem 3-Bromo-4-chloro-5-fluorobenzoic acid | ≥97% | CAS 1357942-87-0 | C7H3BrClFO2 | 5g
3-Bromo-4-chloro-5-fluorobenzoic acid | ≥97% | CAS 1357942-87-0 | C7H3BrClFO2 | 5g
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
2,039
Medchemexpress LLC NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ | 96.5% | 4835.47 | 10 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
This peptide is an angiotensin-converting enzyme 2 (ACE2) related peptide. It serves as a valuable tool for researchers to understand the functions of ACE2.
- Can be used as a tool for understanding ACE2 functions.
- Available in multiple quantities.
- Purity of 96.5%.
- Molecular weight of 4835.47.
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
2,040
Aobchem 3-Bromo-5-chloro-4-fluorobenzotrifluoride | ≥97% | CAS 109919-27-9 | C7H2BrClF4 | 250mg
3-Bromo-5-chloro-4-fluorobenzotrifluoride | ≥97% | CAS 109919-27-9 | C7H2BrClF4 | 250mg
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More