Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 5000399487

Medchemexpress LLC NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ | 96.5% | 4835.47 | 10 MG
SDP

Catalog No. 5000399487
Encompass_Preferred

This peptide is an angiotensin-converting enzyme 2 (ACE2) related peptide. It serves as a valuable tool for researchers to understand the functions of ACE2.

  • Can be used as a tool for understanding ACE2 functions.
  • Available in multiple quantities.
  • Purity of 96.5%.
  • Molecular weight of 4835.47.

Catalog No. 50-003-99487 Supplier Medchemexpress LLC Supplier No. HYP314210MG
May include imposed supplier surcharges.
Add to Cart
Add to Cart

missing translation for 'validMainframeMsg'

This peptide is an angiotensin-converting enzyme 2 (ACE2) related peptide. It serves as a valuable tool for researchers to understand the functions of ACE2.

  • Can be used as a tool for understanding ACE2 functions.
  • Available in multiple quantities.
  • Purity of 96.5%.
  • Molecular weight of 4835.47.

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.