Thiophenes
Organic heterocyclic compounds that consist of a five-membered ring with four carbon atoms, and one sulfur atom.
Quantity
- (1)
- (205)
- (18)
- (1)
- (3)
- (18)
- (4)
- (12)
- (9)
- (85)
- (3)
- (4)
- (4)
- (47)
- (176)
- (3)
- (6)
- (1)
- (7)
- (3)
- (2)
- (1)
- (1)
Molecular Weight (g/mol)
- (1)
- (1)
- (1)
- (1)
- (7)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
- (2)
- (2)
- (3)
- (1)
- (8)
- (16)
- (1)
- (4)
- (4)
- (3)
- (1)
- (4)
- (2)
- (1)
- (5)
- (1)
- (4)
- (3)
- (2)
- (4)
- (1)
- (1)
- (1)
- (6)
- (5)
- (1)
- (1)
- (1)
- (3)
- (2)
- (1)
- (1)
- (2)
- (2)
- (1)
- (1)
- (2)
- (5)
- (1)
- (2)
- (2)
- (1)
- (2)
- (11)
- (2)
- (2)
- (1)
- (1)
- (5)
- (3)
- (1)
- (2)
- (5)
- (6)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (2)
- (1)
- (4)
- (1)
- (7)
- (1)
- (2)
- (5)
- (3)
- (1)
- (6)
- (3)
- (1)
- (1)
- (4)
- (1)
- (2)
- (2)
- (2)
- (5)
- (2)
- (1)
- (10)
- (4)
- (1)
- (2)
- (1)
- (4)
- (2)
- (3)
- (1)
- (1)
- (3)
- (2)
- (2)
- (2)
- (2)
- (1)
- (2)
- (6)
- (1)
- (8)
- (2)
- (2)
- (3)
- (4)
- (4)
- (1)
- (1)
- (2)
- (3)
- (2)
- (3)
- (1)
- (5)
- (4)
- (1)
- (2)
- (1)
- (1)
- (5)
- (1)
- (2)
- (2)
- (7)
- (1)
- (1)
- (2)
- (2)
- (7)
- (2)
- (3)
- (2)
- (2)
- (3)
- (1)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (2)
- (1)
- (1)
- (3)
- (1)
- (1)
- (3)
- (2)
- (1)
- (1)
- (1)
- (2)
- (2)
- (5)
- (2)
- (1)
- (1)
- (1)
- (2)
- (2)
- (1)
- (1)
- (3)
- (1)
- (1)
- (1)
- (1)
- (2)
- (2)
- (3)
- (1)
- (1)
- (4)
- (1)
- (1)
- (1)
- (2)
- (1)
- (2)
- (2)
- (1)
- (5)
- (9)
- (2)
- (1)
- (1)
- (2)
- (1)
- (1)
- (4)
- (2)
- (2)
- (1)
- (1)
- (1)
- (1)
- (4)
- (3)
- (3)
- (2)
- (1)
- (4)
- (1)
- (2)
- (1)
- (2)
- (2)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (3)
- (1)
- (2)
- (3)
- (1)
- (2)
- (1)
- (3)
- (1)
- (2)
- (2)
- (2)
- (3)
- (1)
- (1)
- (2)
- (1)
- (2)
- (6)
- (3)
- (1)
- (2)
- (3)
- (2)
- (1)
- (1)
- (2)
- (1)
- (1)
- (2)
- (5)
- (1)
- (1)
- (1)
- (1)
- (2)
- (2)
- (2)
- (1)
- (2)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
Percent Purity
- (2)
- (1)
- (1)
- (2)
- (10)
- (4)
- (1)
- (5)
- (2)
- (2)
- (23)
- (6)
- (1)
- (1)
- (11)
- (47)
- (2)
- (33)
- (9)
- (1)
- (5)
- (1)
- (7)
- (1)
- (2)
- (1)
- (1)
- (2)
- (5)
- (48)
- (13)
- (190)
- (2)
- (72)
- (3)
- (36)
- (2)
Physical Form
- (5)
- (130)
- (1)
- (1)
- (2)
- (2)
- (65)
- (3)
- (2)
- (7)
- (14)
Boiling Point
- (5)
- (2)
- (3)
- (2)
- (2)
- (1)
- (2)
- (2)
- (1)
- (2)
- (2)
- (1)
- (3)
- (2)
- (1)
- (1)
- (5)
- (1)
- (2)
- (3)
- (1)
- (2)
- (1)
- (1)
- (2)
- (3)
- (3)
- (1)
- (2)
- (2)
- (2)
- (1)
- (3)
- (3)
- (4)
- (2)
- (1)
- (1)
- (1)
- (2)
- (2)
- (3)
- (3)
- (1)
- (3)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (1)
- (2)
- (3)
- (3)
- (2)
- (4)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
- (2)
- (3)
- (3)
- (1)
- (1)
- (1)
- (2)
- (1)
- (2)
- (1)
- (1)
- (1)
- (3)
- (1)
- (1)
- (1)
- (2)
- (1)
- (3)
- (2)
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
Search Within Results
Keyword Search:
Clear All
4,186
–
4,200
of
4,395
results
4,186
Aobchem 3-Bromo-6-chloro-2-fluorobenzoyl chloride | 95% | CAS 1534713-74-0 | C7H2BrCl2FO | 250mg
3-Bromo-6-chloro-2-fluorobenzoyl chloride | 95% | CAS 1534713-74-0 | C7H2BrCl2FO | 250mg
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
4,187
Aobchem 4-Bromo-3-ethoxy-5-fluorobenzoic acid | 97% | CAS 2387237-05-8 | C9H8BrFO3 | 500mg
4-Bromo-3-ethoxy-5-fluorobenzoic acid | 97% | CAS 2387237-05-8 | C9H8BrFO3 | 500mg
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
4,188
Aobchem Ethyl 6-bromo-7-fluorobenzo[b]thiophene-2-carboxylate | 97% | CAS 2168832-98-0 | C11H8BrFO2S | 250mg
Ethyl 6-bromo-7-fluorobenzo[b]thiophene-2-carboxylate | 97% | CAS 2168832-98-0 | C11H8BrFO2S | 250mg
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
4,189
Aobchem 3-Bromo-5-chloro-4-fluorobenzotrifluoride | ≥97% | CAS 109919-27-9 | C7H2BrClF4 | 1g
3-Bromo-5-chloro-4-fluorobenzotrifluoride | ≥97% | CAS 109919-27-9 | C7H2BrClF4 | 1g
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
4,190
Aobchem 5-Bromo-2-chloro-4-fluorobenzoic acid | ≥95% | CAS 1204219-98-6 | C7H3BrClFO2 | 500mg
5-Bromo-2-chloro-4-fluorobenzoic acid | ≥95% | CAS 1204219-98-6 | C7H3BrClFO2 | 500mg
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
4,191
Aobchem 2-Bromo-4-chloro-6-fluorobenzoic acid | ≥95% | CAS 1082040-61-6 | C7H3BrClFO2 | 5g
2-Bromo-4-chloro-6-fluorobenzoic acid | ≥95% | CAS 1082040-61-6 | C7H3BrClFO2 | 5g
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
4,192
Aobchem 3-Bromo-5-chloro-4-fluorobenzoic acid | ≥95% | CAS 176548-68-8 | C7H3BrClFO2 | 5g
3-Bromo-5-chloro-4-fluorobenzoic acid | ≥95% | CAS 176548-68-8 | C7H3BrClFO2 | 5g
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
4,193
Aobchem 5-Bromo-3-ethoxy-2-fluorobenzoic acid | ≥97% | CAS 1801516-14-2 | C9H8BrFO3 | 250mg
5-Bromo-3-ethoxy-2-fluorobenzoic acid | ≥97% | CAS 1801516-14-2 | C9H8BrFO3 | 250mg
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
4,194
Medchemexpress LLC NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ | 96.5% | 4835.47 | 10 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
This peptide is an angiotensin-converting enzyme 2 (ACE2) related peptide. It serves as a valuable tool for researchers to understand the functions of ACE2.
- Can be used as a tool for understanding ACE2 functions.
- Available in multiple quantities.
- Purity of 96.5%.
- Molecular weight of 4835.47.
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
4,195
Aobchem 3-Chloro-5-ethyl-2-fluorobenzoic acid | 95% | CAS 1891236-26-2 | C9H8ClFO2 | 250mg
3-Chloro-5-ethyl-2-fluorobenzoic acid | 95% | CAS 1891236-26-2 | C9H8ClFO2 | 250mg
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
4,196
Aobchem 2-Bromo-4-chloro-5-fluorobenzonitrile | ≥95% | CAS 1893432-29-5 | C7H2BrClFN | 1g
2-Bromo-4-chloro-5-fluorobenzonitrile | ≥95% | CAS 1893432-29-5 | C7H2BrClFN | 1g
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
4,197
Aobchem 3-Bromo-2-ethoxy-6-fluorobenzoic acid | ≥97% | CAS 1784348-10-2 | C9H8BrFO3 | 5g
3-Bromo-2-ethoxy-6-fluorobenzoic acid | ≥97% | CAS 1784348-10-2 | C9H8BrFO3 | 5g
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
4,198
![Aobchem Benzo[b]thiophene 2-bromo- 1 1-dioxide | ≥95% | CAS 5350-05-0 | C8H5BrO2S | 250mg](https://assets.fishersci.com/TFS-Assets/CCG/product-images/5000988015.png-250.jpg)
Aobchem Benzo[b]thiophene 2-bromo- 1 1-dioxide | ≥95% | CAS 5350-05-0 | C8H5BrO2S | 250mg
Benzo[b]thiophene 2-bromo- 1 1-dioxide | ≥95% | CAS 5350-05-0 | C8H5BrO2S | 250mg
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
4,199
![Aobchem 6-Fluoro-benzo[b]thiophene-2-carboxylic acid methyl ester | ≥97% | CAS 550998-52-2 | C10H7FO2S | 1g](https://assets.fishersci.com/TFS-Assets/CCG/product-images/5000989197.png-250.jpg)
Aobchem 6-Fluoro-benzo[b]thiophene-2-carboxylic acid methyl ester | ≥97% | CAS 550998-52-2 | C10H7FO2S | 1g
6-Fluoro-benzo[b]thiophene-2-carboxylic acid methyl ester | ≥97% | CAS 550998-52-2 | C10H7FO2S | 1g
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
4,200
Aobchem 3-Bromo-4-chloro-2-fluorobenzonitrile | ≥97% | CAS 2092624-38-7 | C7H2BrClFN | 500mg
3-Bromo-4-chloro-2-fluorobenzonitrile | ≥97% | CAS 2092624-38-7 | C7H2BrClFN | 500mg
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More