Thiophenes
- (1)
- (204)
- (18)
- (1)
- (3)
- (18)
- (4)
- (12)
- (9)
- (83)
- (3)
- (4)
- (4)
- (46)
- (174)
- (3)
- (6)
- (1)
- (6)
- (3)
- (2)
- (1)
- (1)
- (1)
- (1)
- (1)
- (7)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
- (2)
- (2)
- (3)
- (1)
- (8)
- (16)
- (1)
- (4)
- (4)
- (3)
- (1)
- (4)
- (2)
- (1)
- (5)
- (1)
- (3)
- (3)
- (2)
- (4)
- (1)
- (1)
- (1)
- (6)
- (5)
- (1)
- (1)
- (1)
- (3)
- (2)
- (1)
- (1)
- (2)
- (2)
- (1)
- (1)
- (2)
- (5)
- (1)
- (2)
- (2)
- (2)
- (11)
- (2)
- (2)
- (1)
- (1)
- (5)
- (3)
- (1)
- (2)
- (5)
- (6)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (2)
- (1)
- (4)
- (1)
- (7)
- (1)
- (2)
- (5)
- (3)
- (1)
- (6)
- (3)
- (1)
- (1)
- (4)
- (1)
- (2)
- (2)
- (2)
- (5)
- (2)
- (1)
- (10)
- (4)
- (1)
- (2)
- (1)
- (4)
- (2)
- (3)
- (1)
- (1)
- (3)
- (2)
- (2)
- (2)
- (2)
- (2)
- (6)
- (1)
- (8)
- (2)
- (2)
- (3)
- (4)
- (4)
- (1)
- (1)
- (2)
- (3)
- (2)
- (3)
- (1)
- (5)
- (4)
- (1)
- (2)
- (1)
- (1)
- (5)
- (1)
- (2)
- (2)
- (7)
- (1)
- (1)
- (2)
- (2)
- (7)
- (2)
- (3)
- (2)
- (2)
- (3)
- (1)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (2)
- (1)
- (1)
- (3)
- (1)
- (1)
- (3)
- (2)
- (1)
- (1)
- (1)
- (2)
- (2)
- (5)
- (2)
- (1)
- (1)
- (1)
- (2)
- (2)
- (1)
- (1)
- (3)
- (1)
- (1)
- (1)
- (1)
- (2)
- (2)
- (3)
- (1)
- (1)
- (4)
- (1)
- (1)
- (1)
- (1)
- (2)
- (1)
- (2)
- (2)
- (1)
- (5)
- (9)
- (2)
- (1)
- (2)
- (1)
- (1)
- (4)
- (2)
- (2)
- (1)
- (1)
- (1)
- (4)
- (2)
- (3)
- (2)
- (1)
- (4)
- (1)
- (2)
- (1)
- (2)
- (2)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (3)
- (1)
- (2)
- (3)
- (1)
- (2)
- (1)
- (3)
- (1)
- (2)
- (2)
- (2)
- (3)
- (1)
- (1)
- (2)
- (1)
- (2)
- (6)
- (3)
- (1)
- (2)
- (3)
- (2)
- (1)
- (1)
- (2)
- (1)
- (1)
- (2)
- (5)
- (1)
- (1)
- (1)
- (1)
- (2)
- (2)
- (2)
- (1)
- (2)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
- (2)
- (1)
- (1)
- (2)
- (10)
- (4)
- (5)
- (2)
- (2)
- (23)
- (6)
- (1)
- (1)
- (11)
- (47)
- (2)
- (33)
- (9)
- (1)
- (5)
- (1)
- (7)
- (1)
- (1)
- (2)
- (1)
- (1)
- (2)
- (5)
- (48)
- (13)
- (187)
- (2)
- (72)
- (3)
- (36)
- (2)
- (5)
- (130)
- (1)
- (1)
- (2)
- (2)
- (65)
- (3)
- (2)
- (7)
- (14)
- (5)
- (2)
- (3)
- (2)
- (2)
- (1)
- (2)
- (2)
- (1)
- (2)
- (2)
- (1)
- (3)
- (2)
- (1)
- (1)
- (5)
- (1)
- (2)
- (3)
- (1)
- (2)
- (1)
- (1)
- (2)
- (3)
- (3)
- (1)
- (2)
- (2)
- (2)
- (1)
- (3)
- (3)
- (4)
- (2)
- (1)
- (1)
- (1)
- (2)
- (2)
- (3)
- (3)
- (1)
- (3)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (1)
- (2)
- (3)
- (3)
- (2)
- (4)
- (1)
- (1)
- (1)
- (1)
- (2)
- (2)
- (3)
- (3)
- (1)
- (1)
- (1)
- (2)
- (1)
- (2)
- (1)
- (1)
- (1)
- (3)
- (1)
- (1)
- (1)
- (2)
- (1)
- (3)
- (2)
Filtered Search Results
![Medchemexpress LLC 2-[2-(4-methoxy-2-pyridinyl)ethyl]-1H-imidazo[4,5-b]pyridine, dihydrochloride | 1216722-25-6 | MFCD11100187 | 99.6% | 327.21 g·mol⁻¹ | C14H16Cl2N4O | 5 MG](https://assets.fishersci.com/TFS-Assets/CCG/product-images/5000240418.png-250.jpg)
Medchemexpress LLC 2-[2-(4-methoxy-2-pyridinyl)ethyl]-1H-imidazo[4,5-b]pyridine, dihydrochloride | 1216722-25-6 | MFCD11100187 | 99.6% | 327.21 g·mol⁻¹ | C14H16Cl2N4O | 5 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
BYK 191023 dihydrochloride is a selective inducible nitric-oxide synthase (iNOS) inhibitor used in in vitro and in vivo research to probe iNOS-mediated pathways. It is supplied as a solid research chemical with high purity and is characterized by a defined molecular formula and molecular weight.
- Selective inhibitor of inducible nitric-oxide synthase for mechanistic studies
- High purity (≈99.6%) for reproducible results
- Well-characterized molecular weight 327.21 g·mol⁻¹ and chemical formula C14H16Cl2N4O
- Solid powder form for convenient handling and formulation
- Storage recommendations available for both solid and solution states
- Available in small research quantities suitable for assay development
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules 24430-27-1 | Ambeed | 3-Bromo-2-nitrothiophene | 1g | 552594996 | A155417 | MFCD04971288 | 208.03 | C4H2BrNO2S
Ambeed | Ethyl 6-bromopyrrolo[12-c]pyrimidine-3-carboxylate | 100mg | 491682310 | A823518 | 588720-12-1 | MFCD09878714 | 269.098 | C10H9BrN2O2
If you are unable to find the chemical you are looking for, make sure you are logged into your fishersci.com account and click on the following link:
eMolecules Building Block Tool<|a>
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Sigma Aldrich Fine Chemicals Biosciences 3-Methyl-L-histidine100MG
methyl 3-Methyl-L-histidine100MG
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC MEDCHEMEXPRESS LLC
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
5000742241 3-METHYLTHIOPHENE-2- 10G
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ | 96.5% | 4835.47 | 10 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
This peptide is an angiotensin-converting enzyme 2 (ACE2) related peptide. It serves as a valuable tool for researchers to understand the functions of ACE2.
- Can be used as a tool for understanding ACE2 functions.
- Available in multiple quantities.
- Purity of 96.5%.
- Molecular weight of 4835.47.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules 2096332-07-7 | 3-Chlorothiophene-2,5-diboronic acid | Combi-Blocks | MFCD19981521 | 206.210 | C4H5B2ClO4S | 98.000 | OB(O)c1cc(Cl)c(s1)B(O)O | 1g | 117524371
3-Chlorothiophene-2,5-diboronic acid | Combi-Blocks | 2096332-07-7 | MFCD19981521 | 206.210 | C4H5B2ClO4S | 98.000 | OB(O)c1cc(Cl)c(s1)B(O)O | 1g | 117524371
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC MEDCHEMEXPRESS LLC
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
5000746019 AXKO-0046 DIHYDROCH 50MG
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC MEDCHEMEXPRESS LLC
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
5000744229 3 4-DIBROMO-MAL-PEG8 250MG
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules 53119-60-1 | 2-Bromo-4-methylthiophene | Combi-Blocks | MFCD12033287 | 177.060 | C5H5BrS | 95.000 | Cc1csc(Br)c1 | 1g | 296398169
2-Bromo-4-methylthiophene | Combi-Blocks | 53119-60-1 | MFCD12033287 | 177.060 | C5H5BrS | 95.000 | Cc1csc(Br)c1 | 1g | 296398169
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC VB124 (MCT4 inhibitor) | 2230186-18-0 | MFCD34602725 | 98.9% | C23H23ClN2O4 | 10MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
VB124 is an orally active, potent, and selective monocarboxylate transporter 4 (MCT4) inhibitor used in research to block lactate import and export. It exhibits low-nanomolar cellular activity (IC50 = 8.6 nM for import, 19 nM for export in MDA-MB-231 cells) and is applied in studies of cancer metabolism, cardiac hypertrophy, and heart failure.
- Selective MCT4 inhibition.
- Low-nanomolar potency in cellular assays.
- Redirects glycolytic carbon flux toward mitochondria.
- Available as solid and DMSO solution formulations.
- Recommended storage for powder and solvent formulations.
- High reported purity (~98.9%).
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
AMBEED 6 AMINOBENZO B THIOPHENE 11 5G
NC3725046 6 AMINOBENZO B THIOPHENE 11 5G
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Accela Chembio Inc 5-chloro-2-thiophenecarboxaldehyde | 5g | 7283-96-7 | MFCD00047090 | 97+% | D: 1.376 | Shelf Life: 1260 Days | Light Sensitive/nitrogen Or Argon/+4
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
5-chloro-2-thiophenecarboxaldehyde | 5g | 7283-96-7 | MFCD00047090 | 97+% | D: 1.376 | Shelf Life: 1260 Days | Light Sensitive/nitrogen Or Argon/+4
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules 3-CHLOROTHIOPHENE 250MG
5000190282 3-CHLOROTHIOPHENE 250MG
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Accela Chembio Inc 5-chloro-2-thiophenecarboxaldehyde | 25g | 7283-96-7 | MFCD00047090 | 97+% | D: 1.376 | Shelf Life: 1260 Days | Light Sensitive/nitrogen Or Argon/+4
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
5-chloro-2-thiophenecarboxaldehyde | 25g | 7283-96-7 | MFCD00047090 | 97+% | D: 1.376 | Shelf Life: 1260 Days | Light Sensitive/nitrogen Or Argon/+4
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules 36052-27-4 | Methyl 3-aminopicolinate | ChemScene | MFCD08695602 | 152.153 | C7H8N2O2 | 97.000 | COC(=O)c1ncccc1N | 10g | 536904939
Methyl 3-aminopicolinate | ChemScene | 36052-27-4 | MFCD08695602 | 152.153 | C7H8N2O2 | 97.000 | COC(=O)c1ncccc1N | 10g | 536904939
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More