Primary amines
Organic compounds and functional groups that contain a basic nitrogen atom with a lone pair. Primary amines have a nitrogen atom bonded to two hydrogen atoms, and a carbon atom or other functional group.
Quantity
- (22)
- (141)
- (10)
- (8)
- (4)
- (29)
- (1)
- (4)
- (3)
- (1)
- (72)
- (35)
- (8)
- (2)
- (5)
- (1)
- (1)
- (2)
- (1)
- (1)
- (14)
- (4)
- (1)
- (3)
- (169)
- (57)
- (4)
- (13)
- (17)
- (21)
- (1)
- (6)
- (1)
- (1)
- (1)
- (4)
- (1)
- (181)
- (4)
- (28)
- (15)
- (5)
- (2)
- (41)
- (49)
- (2)
- (1)
- (4)
Molecular Weight (g/mol)
- (14)
- (3)
- (8)
- (4)
- (4)
- (5)
- (4)
- (1)
- (2)
- (2)
- (1)
- (2)
- (2)
- (2)
- (1)
- (5)
- (1)
- (2)
- (4)
- (1)
- (1)
- (24)
- (2)
- (3)
- (4)
- (7)
- (6)
- (2)
- (3)
- (6)
- (7)
- (13)
- (4)
- (2)
- (2)
- (5)
- (13)
- (4)
- (7)
- (14)
- (4)
- (1)
- (1)
- (6)
- (1)
- (2)
- (10)
- (1)
- (4)
- (5)
- (2)
- (5)
- (2)
- (3)
- (2)
- (9)
- (1)
- (3)
- (4)
- (2)
- (2)
- (2)
- (1)
- (9)
- (1)
- (1)
- (3)
- (4)
- (9)
- (4)
- (6)
- (1)
- (2)
- (5)
- (2)
- (2)
- (2)
- (9)
- (5)
- (3)
- (5)
- (2)
- (2)
- (2)
- (6)
- (1)
- (1)
- (3)
- (3)
- (5)
- (1)
- (5)
- (3)
- (4)
- (2)
- (2)
- (3)
- (5)
- (8)
- (3)
- (1)
- (1)
- (2)
- (1)
- (3)
- (7)
- (5)
- (2)
- (3)
- (3)
- (2)
- (3)
- (2)
- (2)
- (8)
- (3)
- (2)
- (3)
- (3)
- (1)
- (8)
- (1)
- (1)
- (1)
- (6)
- (3)
- (8)
- (2)
- (2)
- (19)
- (4)
- (2)
- (9)
- (8)
- (1)
- (1)
- (1)
- (5)
- (6)
- (2)
- (1)
- (5)
- (11)
- (1)
- (2)
- (1)
- (1)
- (2)
- (2)
- (3)
- (11)
- (1)
- (9)
- (2)
- (1)
- (2)
- (6)
- (2)
- (2)
- (4)
- (1)
- (1)
- (1)
- (2)
- (9)
- (2)
- (1)
- (2)
- (1)
- (1)
- (2)
- (1)
- (2)
- (1)
- (1)
- (1)
- (3)
- (2)
- (3)
- (7)
- (1)
- (1)
- (2)
- (1)
- (1)
- (2)
- (1)
- (1)
- (5)
- (1)
- (2)
- (3)
- (2)
- (2)
- (2)
- (1)
- (2)
- (2)
- (1)
- (2)
- (1)
- (6)
- (4)
- (5)
- (1)
- (2)
- (1)
- (2)
- (9)
- (5)
- (16)
- (9)
- (2)
- (8)
- (17)
- (7)
- (5)
- (8)
- (10)
- (10)
- (24)
- (20)
- (2)
- (1)
- (5)
- (8)
- (7)
- (2)
- (1)
- (12)
- (6)
- (6)
- (21)
- (11)
- (7)
- (11)
- (8)
- (4)
- (3)
- (3)
- (8)
- (1)
Percent Purity
- (2)
- (4)
- (1)
- (2)
- (2)
- (12)
- (3)
- (3)
- (5)
- (2)
- (7)
- (4)
- (15)
- (2)
- (3)
- (8)
- (6)
- (3)
- (45)
- (2)
- (40)
- (118)
- (2)
- (7)
- (9)
- (6)
- (18)
- (40)
- (4)
- (14)
- (1)
- (6)
- (13)
- (6)
- (11)
- (2)
- (2)
- (3)
- (4)
- (5)
- (3)
- (2)
- (1)
- (1)
- (13)
- (2)
- (18)
- (8)
- (76)
- (1)
- (161)
- (10)
- (5)
- (144)
- (29)
- (4)
Physical Form
- (2)
- (2)
- (8)
- (15)
- (177)
- (3)
- (5)
- (1)
- (4)
- (3)
- (4)
- (2)
- (3)
- (331)
- (3)
- (4)
- (6)
- (4)
- (2)
- (27)
- (5)
- (4)
- (4)
- (3)
- (2)
- (2)
- (3)
Boiling Point
- (4)
- (5)
- (3)
- (3)
- (3)
- (3)
- (3)
- (6)
- (2)
- (2)
- (1)
- (2)
- (1)
- (2)
- (5)
- (2)
- (3)
- (7)
- (13)
- (2)
- (3)
- (2)
- (2)
- (3)
- (2)
- (1)
- (3)
- (6)
- (2)
- (1)
- (2)
- (2)
- (3)
- (4)
- (2)
- (1)
- (3)
- (2)
- (3)
- (1)
- (2)
- (2)
- (8)
- (1)
- (1)
- (2)
- (5)
- (5)
- (2)
- (3)
- (1)
- (2)
- (5)
- (1)
- (1)
- (2)
- (2)
- (2)
- (3)
- (2)
- (3)
- (2)
- (2)
- (2)
- (3)
- (1)
- (4)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (1)
- (3)
- (1)
- (3)
- (3)
- (2)
- (4)
- (1)
- (2)
- (3)
- (2)
- (2)
- (2)
- (1)
- (4)
- (3)
- (2)
- (2)
- (3)
- (1)
- (3)
- (1)
- (4)
- (2)
- (2)
- (6)
- (4)
- (7)
- (3)
- (3)
- (2)
- (2)
- (5)
- (4)
- (2)
- (7)
- (1)
- (3)
- (3)
- (3)
- (2)
- (1)
- (2)
- (6)
- (2)
- (4)
- (1)
- (4)
- (2)
- (3)
- (3)
- (3)
- (2)
- (3)
- (2)
- (1)
- (3)
- (2)
- (1)
- (3)
- (3)
- (2)
- (1)
- (2)
- (2)
- (1)
- (3)
- (2)
- (5)
- (2)
- (2)
- (1)
- (5)
- (4)
- (2)
- (4)
- (2)
- (3)
- (2)
- (4)
- (3)
- (2)
- (6)
- (2)
- (1)
- (4)
- (6)
- (3)
- (2)
- (7)
- (2)
- (2)
- (3)
- (2)
- (2)
- (4)
- (10)
- (2)
- (1)
- (5)
- (5)
- (2)
- (1)
- (1)
- (2)
- (4)
- (4)
- (2)
- (2)
- (2)
- (4)
- (3)
- (2)
- (2)
- (2)
- (5)
- (4)
- (5)
- (4)
- (3)
- (2)
- (2)
- (2)
- (3)
- (3)
- (1)
- (3)
- (2)
- (2)
- (2)
- (3)
- (2)
- (3)
- (2)
- (2)
- (3)
- (1)
- (2)
- (3)
- (3)
- (1)
- (3)
- (4)
- (1)
- (2)
- (1)
- (1)
- (3)
- (2)
- (2)
- (7)
- (2)
- (1)
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
Search Within Results
Keyword Search:
Clear All
496
–
510
of
927
results
496
Aobchem AOBCHEM
5000950699 5- 4-BROMOPHENYL -1 3 4-OXADIA
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
497
Aobchem AOBCHEM
5000958410 2- 3-FLUOROPHENOXY ANILINE 250
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
498
Aobchem AOBCHEM
5001049024 3- 3-FLUOROPHENOXY ANILINE 250
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
499
Sigma Aldrich Fine Chemicals Biosciences Tyramine hydrochloride >=98% | 60-19-5 | MFCD00012901 | 10MG
Tyramine hydrochloride >=98% | Purity: >=98% | Mol Wt: 173.64 | 60-19-5 | MFCD00012901 | 10MG
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
500
Medchemexpress LLC Vuf 8430 dihydrobromide | 100130-32-3 | 98.0% | 323.05 g/mol | C4H13Br2N5S | 10 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
VUF 8430 dihydrobromide is a potent, selective histamine H4 receptor agonist supplied as a solid research reagent. It exhibits a Ki of 31.6 nM and an EC50 of 50 nM at the H4 receptor, and is provided in small milligram quantities for pharmacological and biochemical studies. For research use only.
- Purity 98.0%
- Molecular weight 323.05 g/mol
- CAS 100130-32-3
- Appearance solid
- Potency Ki = 31.6 nM; EC50 = 50 nM (histamine H4 receptor)
- Available in small milligram pack sizes, including 10 mg
- Intended for research use only
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
501
Medchemexpress LLC STIEEQAKTFLDKFNHEAEDLFYQSSLASWN | 95.3% | 3649.88 | 5 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN | 95.3% | 3649.88 | 5 MG
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
502
Chembridge Corporation 3-(2-FURYL)ANILINE
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
[3-(2-furyl)phenyl]amine hydrochloride; CAS: 102269-42-1
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
503
Medchemexpress LLC BD-1047 dihydrobromide | 138356-21-5 | 98.45% | 437.04 | 1 ML
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
BD-1047 dihydrobromide is a selective functional antagonist of sigma receptors. It attenuates Apomorphine-induced climbing and Phencyclidine-induced head twitches. It is for research use only and not sold to patients.
- Selective functional antagonist of sigma receptors.
- Attenuates Apomorphine-induced climbing.
- Attenuates Phencyclidine-induced head twitches.
- Prevents Cutamesine from reducing cell death induced by light exposure in murine photoreceptor-derived 661w cells.
- Attenuates Cutamesine from reducing mitochondrial damage and elevated caspase 3/7 activity.
- Decreases APO-induced climbing behavior at 10 mg/kg in mice.
- Counteracts the antidepressant-like effect induced by co-administration of pramipexole and sertraline.
- Reduces the increasing expression of pNR1 and reverses Sig-1 R agonists potentiated NMDA-induced pain behavior and pNR1 immunoreactivity.
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
504
Medchemexpress LLC Bis(2-methyl-3-furyl)disulfide | 28588-75-2 | 98.4% | 226.31 | 1 G
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Bis(2-methyl-3-furyl)disulfide is a chemical compound designed to act as a flavoring agent. It is intended to enhance the natural, fresh, and milk-rich feeling of milk-related products. This product is for research use only.
- Functions as a flavoring compound.
- Enhances natural, fresh, and milk-rich feelings.
- Has a purity of 98.37%.
- Molecular weight is 226.31.
- CAS number is 28588-75-2.
- Recommended storage for pure form: -20°C for 3 years or 4°C for 2 years.
- Recommended storage in solvent: -80°C for 6 months or -20°C for 1 month.
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
505
Medchemexpress LLC MEDCHEMEXPRESS LLC
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
5000739187 A-ETHYL 2C-D HYDROC 5MG
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
506
Sigma Aldrich Fine Chemicals Biosciences Aminophylline >=98%, powder | 317-34-0 | MFCD00013221 | 100G
Aminophylline >=98%, powder | Purity: >=98% | Mol Wt: 210.21 | 317-34-0 | MFCD00013221 | 100G
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
507
![Medchemexpress LLC 2-[(aminoiminomethyl)amino]ethyl carbamimidothioic acid ester dihydrobromide | 100130-32-3 | 98.0% | 323.05 g/mol | C4H13Br2N5S | 5 MG](https://assets.fishersci.com/TFS-Assets/CCG/product-images/5000241398.png-250.jpg)
Medchemexpress LLC 2-[(aminoiminomethyl)amino]ethyl carbamimidothioic acid ester dihydrobromide | 100130-32-3 | 98.0% | 323.05 g/mol | C4H13Br2N5S | 5 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
VUF 8430 dihydrobromide is a research-grade histamine H4 receptor agonist used in pharmacological and biochemical studies. It is supplied as a dihydrobromide salt with high reported potency and solubility, suitable for in vitro assays and receptor characterization.
- Potent and selective H4 receptor agonist (Ki 31.6 nM; EC50 50 nM).
- High purity of 98.0% for reproducible results.
- Molecular weight 323.05 g/mol, white to off-white solid.
- High water solubility (125 mg/mL) for assay preparation.
- Available supporting documentation: data sheet, COA, SDS, NMR, MS.
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
508
eMolecules 822-08-2 | 1,11-Diaminoundecane | MFCD00142358 | 5g
Combi-Blocks | 1,11-Diaminoundecane | 5g | 267201770 | QG-1632 | 95.000 | 822-08-2 | MFCD00142358 | 186.343 | C11H26N2
If you are unable to find the chemical you are looking for, make sure you are logged into your fishersci.com account and click on the following link:
eMolecules Building Block Tool<|a>
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
509
Aobchem AOBCHEM
5000957706 2- 3-FLUOROPHENOXY ANILINE 500
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
510
Selleck Chemical LLC 2-Aminoheptane S4520-100mg
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
2-Aminoheptane (Tuaminoheptanez Tuamine Heptamine 1-Methylhexylamine 2-Heptylamine) is a nasal decongestant drug which is a sympathomimetic stimulant and vasoconstrictor
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More