Cell Culture Media
-cell-culture-media-header-image-v2.jpg-250.jpg)
Amsbio LLC MatriMix (511) Fully Definied 3D ECM Hydrogel for Cell Culture
MatriMix is a 3D culture substrate product developed with the aim of culturing cells in an environment similar to that in vivo. It is fully defined, containing collagen, laminin E8 fragments and hyaluronic acid, and types and concentrations of individual components can be customized to provide the optimal extracellular environment for target cells. MAIN FEATURES: Fully defined | Regulatory friendly (medical grade collagen and laminin is available) | Solution at 4C – becomes a clear gel when incubated at 37C | Multi-organ organoid formation | Suitable for Xenograft transplantation | High batch-to-batch reproducibility between vials | Highly versatile (can be used with a variety of cells including iPSCs and ASCs) | Cell culture of various organ tissues possible by adjusting collagen type and concentration, laminin isoform, and various ECM components | Drug Screening more representative of in vivo testing compared to Matrigel™ and other BME equivalents.
Amsbio LLC Fibronectin (Type III CS-1) MAPTrix™-F, EILDVPST containing 2.5 mg protein in solution, (conc. = 0.5mg/mL; aqueous), 5mL per vial
Fibronectin (Type III CS-1) MAPTrix™-F EILDVPST containing 2.5 mg protein in solution (conc. = 0.5mg/mL; aqueous) 5mL per vial
Amsbio LLC MAPTrix HyGel™-V, Vitronectin Hydrogel Kit, FRHRNRKGY
MAPTrix HyGel™-V Vitronectin Hydrogel Kit FRHRNRKGY
Amsbio LLC Fibronectin (III-14) MAPTrix™-F, PRARITGYIIKYEKPGSPPREVVPRPRPGV containing 10.0 mg protein in solution, (conc. = 1mg/mL; aqueous) 10mL per vial
Fibronectin (III-14) MAPTrix™-F PRARITGYIIKYEKPGSPPREVVPRPRPGV containing 10.0 mg protein in solution (conc. = 1mg/mL; aqueous) 10mL per vial
Amsbio LLC Collagen (Type I a1) MAPTrix™-C, GFPGER containing 2.5 mg protein in solution, (conc. = 0.5mg/mL; aqueous), 5mL per vial
Collagen (Type I a1) MAPTrix™-C GFPGER containing 2.5 mg protein in solution (conc. = 0.5mg/mL; aqueous) 5mL per vial
Amsbio LLC Fibronectin MAPTrix™-F, PHSRN-RGDSP containing 2.5 mg protein in solution, (conc. = 0.5mg/mL; aqueous), 5mL per vial
Fibronectin MAPTrix™-F PHSRN-RGDSP containing 2.5 mg protein in solution (conc. = 0.5mg/mL; aqueous) 5mL per vial
Amsbio LLC Fibronectin (III-13) MAPTrix™-F, VSPPRRARVTDATETTITISWRTKTETITGFG 2.5 mg protein in solution, (conc. = 0.5mg/mL; aqueous), 5mL per vial
Fibronectin (III-13) MAPTrix™-F VSPPRRARVTDATETTITISWRTKTETITGFG 2.5 mg protein in solution (conc. = 0.5mg/mL; aqueous) 5mL per vial
Amsbio LLC Fibronectin MAPTrix™-F, RGD containing 2.5 mg protein in solution, (conc. = 0.5mg/mL; aqueous), 5mL per vial
Fibronectin MAPTrix™-F RGD containing 2.5 mg protein in solution (conc. = 0.5mg/mL; aqueous) 5mL per vial
Amsbio LLC Fibronectin (Type III-10) MAPTrix™-F, GRGDSP containing 10.0 mg protein in solution, (conc. = 1mg/mL; aqueous) 10mL per vial
Fibronectin (Type III-10) MAPTrix™-F GRGDSP containing 10.0 mg protein in solution (conc. = 1mg/mL; aqueous) 10mL per vial
Amsbio LLC MAPTrix HyGel™-F, Fibronectin Hydrogel Kit, PHSRN
MAPTrix HyGel™-F Fibronectin Hydrogel Kit PHSRN
Amsbio LLC MAPTrix HyGel™-F, Fibronectin Hydrogel Kit, PHSRN-RGDSP
MAPTrix HyGel™-F Fibronectin Hydrogel Kit PHSRN-RGDSP
Amsbio LLC MAPTrix HyGel™-F, Fibronectin Hydrogel Kit, REDV
MAPTrix HyGel™-F Fibronectin Hydrogel Kit REDV
Amsbio LLC MAPTrix HyGel™-V, Vitronectin Hydrogel Kit, KKQRFRHRNRKGYRSQ
MAPTrix HyGel™-V Vitronectin Hydrogel Kit KKQRFRHRNRKGYRSQ
Amsbio LLC Fibronectin (FN-C/H-II) MAPTrix™-F, KPDVRSYTITG containing 2.5 mg protein in solution, (conc. = 0.5mg/mL; aqueous), 5mL per vial
Fibronectin (FN-C/H-II) MAPTrix™-F KPDVRSYTITG containing 2.5 mg protein in solution (conc. = 0.5mg/mL; aqueous) 5mL per vial
Amsbio LLC Fibronectin (IIICS-1) MAPTrix™-F, VVIDASTAIDAPSNL containing 2.5 mg protein in solution, (conc. = 0.5mg/mL; aqueous), 5mL per vial
Fibronectin (IIICS-1) MAPTrix™-F VVIDASTAIDAPSNL containing 2.5 mg protein in solution (conc. = 0.5mg/mL; aqueous) 5mL per vial