Cell Culture Media
-cell-culture-media-header-image-v2.jpg-250.jpg)
Amsbio LLC Fibronectin MAPTrix™-F, RGD containing 10.0 mg protein in solution, (conc. = 1mg/mL; aqueous) 10mL per vial
Fibronectin MAPTrix™-F RGD containing 10.0 mg protein in solution (conc. = 1mg/mL; aqueous) 10mL per vial
Amsbio LLC Fibronectin (Type III-10) MAPTrix™-F, GRGDSP containing 10.0 mg protein in solution, (conc. = 1mg/mL; aqueous) 10mL per vial
Fibronectin (Type III-10) MAPTrix™-F GRGDSP containing 10.0 mg protein in solution (conc. = 1mg/mL; aqueous) 10mL per vial
Amsbio LLC Fibronectin (III-14) MAPTrix™-F, PRARITGYIIKYEKPGSPPREVVPRPRPGV containing 10.0 mg protein in solution, (conc. = 1mg/mL; aqueous) 10mL per vial
Fibronectin (III-14) MAPTrix™-F PRARITGYIIKYEKPGSPPREVVPRPRPGV containing 10.0 mg protein in solution (conc. = 1mg/mL; aqueous) 10mL per vial
Amsbio LLC Fibronectin (FN-C/H-1V) MAPTrix™-F, SPPRRARVT containing 10.0 mg protein in solution, (conc. = 1mg/mL; aqueous) 10mL per vial
Fibronectin (FN-C/H-1V) MAPTrix™-F SPPRRARVT containing 10.0 mg protein in solution (conc. = 1mg/mL; aqueous) 10mL per vial
Amsbio LLC Fibronectin (IIICS-1) MAPTrix™-F, VVIDASTAIDAPSNL containing 10.0 mg protein in solution, (conc. = 1mg/mL; aqueous) 10mL per vial
Fibronectin (IIICS-1) MAPTrix™-F VVIDASTAIDAPSNL containing 10.0 mg protein in solution (conc. = 1mg/mL; aqueous) 10mL per vial
Amsbio LLC MAPTrix HyGel™-F, Fibronectin Hydrogel Kit, REDV
MAPTrix HyGel™-F Fibronectin Hydrogel Kit REDV
Amsbio LLC Fibronectin (III-14 (FN-C/H-V)) MAPTrix™-F, WQPPRARITGYIIKYEKPG containing 2.5 mg protein in solution, (conc. = 0.5mg/mL; aqueous), 5mL per vial
Fibronectin (III-14 (FN-C/H-V)) MAPTrix™-F WQPPRARITGYIIKYEKPG containing 2.5 mg protein in solution (conc. = 0.5mg/mL; aqueous) 5mL per vial
ILEX LIFE SCIENCES LLC 3-D LIFE THIOGLYCEROL 180 UL
3-D Life Thioglycerol, negative control component to ensure equal gel strengths in 3-D Life Hydrogels (180 ul). INTRO: 3-D Life technology, manufactured in Germany by Cellendes GmbH, is an integrated system for the generation of hydrogels used in 3D cell culture. 3-D Life represents the most flexible system for biomimetic hydrogel design. DESCRIPTION: 3-D Life Thioglycerol (CAS-No. 96-27-5) can be covalently coupled with its thiol group to SH-reactive groups of Dextran or PVA polymers to modify 3-D Life Hydrogels. Concentration of reactive groups: 20 mmol/L. For more information and instructions, please consult the 3-D Life Hydrogels User Guide. APPLICATION: 3-D Life Thioglycerol is used as a negative control in place of peptides to modify 3-D Life Hydrogels. If comparative studies at different peptide concentrations are to be made, a corresponding amount of the cell neutral Thioglycerol should be added to ensure equal gel strengths between gels (see Table 4 and 5 in the User Guide).
Amsbio LLC MAPTrix HyGel™-F, Fibronectin Hydrogel Kit, PHSRN
MAPTrix HyGel™-F Fibronectin Hydrogel Kit PHSRN
Amsbio LLC MAPTrix HyGel™-F, Fibronectin Hydrogel Kit, REDV
MAPTrix HyGel™-F Fibronectin Hydrogel Kit REDV
Amsbio LLC MAPTrix HyGel™-V, Vitronectin Hydrogel Kit, KKQRFRHRNRKGYRSQ
MAPTrix HyGel™-V Vitronectin Hydrogel Kit KKQRFRHRNRKGYRSQ
Amsbio LLC Fibronectin (III-13) MAPTrix™-F, VSPPRRARVTDATETTITISWRTKTETITGFG 2.5 mg protein in solution, (conc. = 0.5mg/mL; aqueous), 5mL per vial
Fibronectin (III-13) MAPTrix™-F VSPPRRARVTDATETTITISWRTKTETITGFG 2.5 mg protein in solution (conc. = 0.5mg/mL; aqueous) 5mL per vial
Amsbio LLC MAPTrix HyGel™-V, Vitronectin Hydrogel Kit, FRHRNRKGY
MAPTrix HyGel™-V Vitronectin Hydrogel Kit FRHRNRKGY
Amsbio LLC MAPTrix HyGel™-V, Vitronectin Hydrogel Kit, KKQRFRHRNRKGYRSQ
MAPTrix HyGel™-V Vitronectin Hydrogel Kit KKQRFRHRNRKGYRSQ
Amsbio LLC MAPTrix HyGel™-F, Fibronectin Hydrogel Kit, PHSRN-RGDSP
MAPTrix HyGel™-F Fibronectin Hydrogel Kit PHSRN-RGDSP