Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Amsbio LLC Fibronectin (III-13) MAPTrix™-F, VSPPRRARVTDATETTITISWRTKTETITGFG 2.5 mg protein in solution, (conc. = 0.5mg/mL; aqueous), 5mL per vial

Supplier:  Amsbio LLC 161122

Encompass

Fibronectin (III-13) MAPTrix™-F VSPPRRARVTDATETTITISWRTKTETITGFG 2.5 mg protein in solution (conc. = 0.5mg/mL; aqueous) 5mL per vial

Catalog No. 50-256-6854


May include imposed supplier surcharges.
Only null left
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.