Learn More
Amsbio LLC Fibronectin (III-13) MAPTrix™-F, VSPPRRARVTDATETTITISWRTKTETITGFG 2.5 mg protein in solution, (conc. = 0.5mg/mL; aqueous), 5mL per vial
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.