Chicken Secondary Antibodies
Kingfisher Biotech Inc Chicken TNFSF15 Recombinant Protein
The Chicken TNFSF15 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken TNFSF15 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken TNFSF15 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken TNFSF15 Specifications: (Molecular Weight: 19.1 kDa) (Amino Acid Sequence: ERSSHFLKQRAVAAVTDTLPSAEKPRAHLTVKKQEPSSTTGSHLPILQWEDKRGLAFTKNNLSYSSNALVIPVSGDYYVYAQVTFRGPSDTSSKTSSVTAVITKVTDSYPEPTQLLTSTKTLSEERNNWFQPIYLGAVVSLEIGDKLMVNVSDIKLVDYTKEHKTFFGAFLL) (Gene ID: 417247). For research use only. Made in the USA
Abcam Chicken Anti-Goat IgG H&L (FITC) preadsorbed.
Chicken Anti-Goat IgG H&L (FITC) preadsorbed.
The product is subject to the following: Abcam Restricted Use Statement
Immunoreagents Inc CHICKEN A-RAT IGG AP
Secondary Antibody; Chicken anti-rat IgG (H&L) - Affinity Pure, Host: Chicken, Format: Liq, Label: None, Applications: WB, ELISA, IHC/ICC, IF, IP, FC
Immunoreagents Inc CHICKEN A-RAT IGG DYLIGHT 550
Secondary Antibody; Chicken anti-rat IgG (H&L) - Affinity Pure, min x w/Hu or Rb IgG or Serum Proteins, DyLight 550 Conjugate, Host: Chicken, Format: Lyo, Label: DyL550, Applications: WB, ELISA, IHC/ICC, IF, IP, FC, FACS
Immunoreagents Inc CHICKEN A-GOAT IGG BIO 0.5MG
Secondary Antibody; Chicken anti-goat IgG (H&L), Affinity Pure, min x w/Hu,Mu or RB IgG/SP, Biotin Conjugate, Host: Chicken, Format: Liq, Label: Biotin, Applications: WB, ELISA, IHC/ICC
Immunoreagents Inc CHICKEN A-GOAT IGG FITC 0.5MG
Secondary Antibody; Chicken anti-goat IgG (H&L), Affinity Pure, min x w/Hu,Mu or RB IgG/SP, FITC Conjugate, Host: Chicken, Format: Liq, Label: FITC, Applications: WB, ELISA, IHC/ICC, IF, IP, FC, FACS
Immunoreagents Inc CHICKEN A-RABBIT IGG FITC
Secondary Antibody; Chicken anti-rabbit IgG (H&L) - Affinity Pure, min x w/Hu or Mu IgG, FITC Conjugate, Host: Chicken, Format: Liq, Label: FITC, Applications: WB, ELISA, IHC/ICC, IF, IP, FC, FACS
Immunoreagents Inc CHICKEN A-MOUSE IGG BIO
Secondary Antibody; Chicken anti-mouse IgG (H&L) - Affinity Pure, min x w/Hu or Rb IgG/Serum Proteins, Biotin Conjugate, Host: Chicken, Format: Liq, Label: Biotin, Applications: WB, ELISA, IHC/ICC
Immunoreagents Inc CHICKEN A-RABBIT IGG DYLIT550
Secondary Antibody; Chicken anti-rabbit IgG (H&L) - Affinity Pure, DyLight 550 Conjugate, Host: Chicken, Format: Lyo, Label: DyL550, Applications: WB, ELISA, IHC/ICC, IF, IP, FC, FACS
Biolegend Ultra-LEAFTM Purified Human Ig
Ultra-LEAF Purified Human IgG3 Isotype Ctrl Recombinant [QA16A14] Isotype Human IgG3 Apps FC Size 100 g