Rat Secondary Antibodies
ABclonal Technology PE/Cyanine7 anti-h CD90/Thy1
This gene encodes a cell surface glycoprotein and member of the immunoglobulin superfamily of proteins The encoded protein is involved in cell adhesion and cell communication in numerous cell types but particularly in cells of the immune and nervous systems The encoded protein is widely used as a marker for hematopoietic stem cells This gene may function as a tumor suppressor in nasopharyngeal carcinoma Alternative splicing results in multiple transcript variants
American Research Products Inc AntiHuman Hepsin
Anti-Human Hepsin [2D5] In Vivo Antibody - Low Endotoxin is a in vivo antibody with human reactivity produced in mouse Available in 100 mg size with 7 - 14 business days lead time Ships via gel pack Functional grade preclinical antibodies may be stored sterile as received at 2-8 C for up to one month For longer term storage aseptically aliquot in working volumes without diluting and store at -80 C Avoid Repeated Freeze Thaw Cycles
American Research Products Inc AntiHuman CD45 Ab
Anti-Human CD45 Antibody [BC8] In Vivo Antibody - Ultra Low Endotoxin is a in vivo antibody with human reactivity produced in mouse Available in 100 mg size with 7 - 14 business days lead time Ships via gel pack Functional grade preclinical antibodies may be stored sterile as received at 2-8 C for up to one month For longer term storage aseptically aliquot in working volumes without diluting and store at -80 C Avoid Repeated Freeze Thaw Cycles
American Research Products Inc AntiHuman CD307e
Anti-Human CD307e (FcRL5) In Vivo Antibody - Ultra Low Endotoxin is a in vivo antibody with human reactivity produced in mouse Available in 100 mg size with 7 - 14 business days lead time Ships via gel pack Functional grade preclinical antibodies may be stored sterile as received at 2-8 C for up to one month For longer term storage aseptically aliquot in working volumes without diluting and store at -80 C Avoid Repeated Freeze Thaw Cycles
Biolegend Spark UV™ 387 anti-mouse CD90.2 (Thy1.2) [S20008D]; Isotype: Mouse IgG2b, κ; Reactivity: Mouse; Apps: FC; Size: 25 μg
Spark UV™ 387 anti-mouse CD90.2 (Thy1.2) [S20008D]; Isotype: Mouse IgG2b, κ; Reactivity: Mouse; Apps: FC; Size: 25 μg
American Research Products Inc Anti CD162 SELPLG PSGL 1 268
Anti-Human CD162/SELPLG/PSGL-1 (AbGn-268) Research Grade
Bethyl Laboratories, Inc Sheep Anti-Human Hemoglobin F Antibody Fitc Conjugated
Sheep anti-Human Hemoglobin F Antibody FITC Conjugated
CPC Scientific H-Ile-Pro-Ile-Tyr-Glu-Lys-Lys-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu-OH (trifluoroacetate salt) 0.5MG
SEQUENCE: H-Ile-Pro-Ile-Tyr-Glu-Lys-Lys-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu-OH (trifluoroacetate salt)(Cys20 and 40, Cys14 and 32, Cys34 and 47)ONE-LETTER SEQUENCE: IPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL (Cys20 and 40 bridge, Cys14 and 32 bridge, Cys34 and 47 bridge)MOLECULAR FORMULA: C226H367N65O65S7MOLECULAR WEIGHT: 5259.34STORAGE CONDITIONS: -20 5 CCAS REGISTRY NUMBER: [209615-79-2]SYNONYMS: CART (55-102) (rat)RESEARCH AREA: ObesityREFERENCES:SKU(s): CART-002A, CART-002B