Protein Labeling Reagents
![eMolecules Broadpharm / AFDye 430 NHS Ester / 5mg / 599128593 / BP-25543 / / 467233-93-8 / [null] / 600.560 / C26H27F3N2O9S](https://assets.fishersci.com/TFS-Assets/CCG/product-images/502470047.JPG-250.jpg)
eMolecules Broadpharm / AFDye 430 NHS Ester / 5mg / 599128593 / BP-25543 / / 467233-93-8 / [null] / 600.560 / C26H27F3N2O9S
Broadpharm / AFDye 430 NHS Ester / 5mg / 599128593 / BP-25543 / / 467233-93-8 / [null] / 600.560 / C26H27F3N2O9S
eMolecules Fluorescein isothiocyanate isomer I, tech grade | Combi-Blocks | 3326-32-7 | MFCD00005063 | 389.380 | C21H11NO5S | 98.000 | Oc1ccc2c(Oc3cc(O)ccc3C22OC(=O)c3cc(ccc23)N=C=S)c1 | 1g | 232307473
Fluorescein isothiocyanate isomer I, tech grade | Combi-Blocks | 3326-32-7 | MFCD00005063 | 389.380 | C21H11NO5S | 98.000 | Oc1ccc2c(Oc3cc(O)ccc3C22OC(=O)c3cc(ccc23)N=C=S)c1 | 1g | 232307473
Cell Signaling Technology PTMScan R O-GlcNAc GlcNAc-ST Motif Kit 1 Kit
PTMScan R O-GlcNAc GlcNAc-ST Motif Kit 1 Kit
CPC Scientific TAMRA-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH (trifluoroacetate salt) 0.5MG
Brain natriuretic peptide or B-type natriuretic peptide (BNP) (also ventricular natriuretic peptide) is a 32-amino acid peptide secreted by heart ventricles in response to excessive stretching of heart muscle cells (cardiomyocytes).ONE-LETTER SEQUENCE: TAMRA-SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Cys10 and 26 bridge)MOLECULAR FORMULA: C168H266N52O46S4MOLECULAR WEIGHT:3878.6STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [114471-18-0], RESEARCH AREA: CardiovascularREFERENCES: T. Sudoh et al., BBRC, 159, 1427 (1989)
![eMolecules Broadpharm / Iodoacetamido-PEG3-NHS ester / 50mg / 784455349 / BP-29931 / 95.000 / 2512227-27-7 / [null] / 486.259 / C15H23IN2O8](https://assets.fishersci.com/TFS-Assets/CCG/product-images/502478459.JPG-250.jpg)
eMolecules Broadpharm / Iodoacetamido-PEG3-NHS ester / 50mg / 784455349 / BP-29931 / 95.000 / 2512227-27-7 / [null] / 486.259 / C15H23IN2O8
Broadpharm / Iodoacetamido-PEG3-NHS ester / 50mg / 784455349 / BP-29931 / 95.000 / 2512227-27-7 / [null] / 486.259 / C15H23IN2O8
Cell Signaling Technology PathScanR Cleaved PARP Asp214 Sandwich ELISA Kit 10 Kit
PathScanR Cleaved PARP Asp214 Sandwich ELISA Kit 10 Kit
TWD Scientific LLC Mag NHS BioXbeads Kit 2 m Beads 5mL (10mg/mL)
Mag NHS BioXbeads Kit 2 m Beads 5mL (10mg/mL)
LICOR IRDye 800CW NHS Ester (50mg)
IRDye infrared dyes from LI-COR Biosciences are available for researchers developing applications using near-infrared (NIR) fluorescence. These unique dyes are used in a variety of NIR imaging applications including Western blotting, plate-based assays, protein arrays, tissue section imaging, and molecular activity measurements. Standard NHS ester chemistry is used to produce custom probes labeled with LI-COR IRDye infrared dyes. The NHS ester reactive group provides the functionality for labeling primary and secondary amines, such as lysine residues in proteins.
LICOR IRDye 680RD NHS Ester (50 mg)
IRDye infrared dyes from LI-COR Biosciences are available for researchers developing applications using near-infrared (NIR) fluorescence. These unique dyes are used in a variety of NIR imaging applications including Western blotting, plate-based assays, protein arrays, tissue section imaging, and molecular activity measurements. Standard NHS ester chemistry is used to produce custom probes labeled with LI-COR IRDye infrared dyes. The NHS ester reactive group provides the functionality for labeling primary and secondary amines, such as lysine residues in proteins.
Sartorius pHrodo Orange Cell Labeling Kit, Real-Time Phagocytosis Quantification, Compatible With IncuCyte System, 1 Kit
The Sartorius IncuCyte pHrodo Orange Cell Labeling Kit provides a reliable solution for quantifying phagocytosis and efferocytosis using live-cell imaging. It features a unique pH-sensitive fluorophore that offers low fluorescence at neutral pH and a significant increase in fluorescence under acidic conditions. This enables real-time evaluation of cellular behaviors affected by various factors, setting it apart from other assays.
Apexbio Technology LLC Cy3 NHS ester, 25mg. Cas: MFCD: MFCD28505569. Labeling of amino-groups in biomolecules.
Sulfo-Cy3 NHS ester is a sulfonated, hydrophilic and highly water soluble dye. For labeling proteins and peptides, no organic co-solvent is needed. Other sizes are available. Please inqury us for quote.
![eMolecules Broadpharm / TAMRA-Azide-PEG-Biotin / 5mg / 268505047 / BP-22474 / 93.000 / 1797415-74-7 / [null] / 1174.380 / C57H79N11O14S](https://assets.fishersci.com/TFS-Assets/CCG/product-images/502477630.JPG-250.jpg)
eMolecules Broadpharm / TAMRA-Azide-PEG-Biotin / 5mg / 268505047 / BP-22474 / 93.000 / 1797415-74-7 / [null] / 1174.380 / C57H79N11O14S
Broadpharm / TAMRA-Azide-PEG-Biotin / 5mg / 268505047 / BP-22474 / 93.000 / 1797415-74-7 / [null] / 1174.380 / C57H79N11O14S
Cayman Chemical 17a 20-DIhydroxy-4-pregn-3 5mg
An endogenous, maturation-inducing steroid that at 1 UG/ml induces germinal vesicle breakdown in oocytes from several teleost species; can also influence spermiation by stimulating milt production when administered at 5 mg/kg to various male teleosts
Biotium Phalloidin, CF640R, 50 U
Phalloidin conjugates are actin filament stains for fixed and permeabilized cells. CF dyes are Biotium's line of next-generation fluorescent dyes with advantages in brightness, photostability, and conjugate specificity compared to other fluorescent dyes. Far-red fluorescent CF640R has excitation/emission at 642/662 nm.