
Cell Line Lysates
Biofluids containing aggregate cellular material produced by the disintegration or dissolution of a variety of cell lines; designed for use in immunoprecipitation and immunoassay procedures.
Host Species
- (1)
- (1)
- (100)
- (2)
- (43)
- (26)
Tissue
- (2)
- (1)
- (2)
- (1)
- (7)
- (3)
- (4)
- (8)
- (3)
- (1)
- (1)
- (1)
- (2)
- (2)
- (1)
- (1)
- (3)
- (2)
- (2)
- (1)
- (1)
- (1)
- (3)
- (2)
- (2)
- (5)
- (8)
- (1)
- (15)
- (11)
- (2)
- (4)
- (1)
- (2)
- (3)
- (2)
- (3)
- (2)
- (1)
- (1)
- (6)
- (2)
- (1)
- (1)
- (2)
- (3)
- (1)
Physical Form
- (17)
Conjugate
- (2)
- (14)
Form
- (16)
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.

106
–
120
of
4,853
results
T-47D (human breast duct carinoma) Whole cell lysate, Denatured; Abnova
Non-denatured whole cell lysate of T-47D (human breast duct carinoma)
Invitrogen™ Human GTPBP2 (aa 65-165) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | DGNIEYKLKLVNPSQYRFEHLVTQMKWRLQEGRGEAVYQIGVEDNGLLVGLAEEEMRASLKTLHRMAEKVGADITVLREREVDYDSDMPRKITEVLVRKVP |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human GTPBP2 (aa 65-165) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human CPT2 (aa 184-268) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | DTITFKRLIRFVPSSLSWYGAYLVNAYPLDMSQYFRLFNSTRLPKPSRDELFTDDKARHLLVLRKGNFYIFDVLDQDGNIVSPSE |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human CPT2 (aa 184-268) Control Fragment |
Recombinant | Recombinant |
A-549 (human lung carcinoma) Whole cell lysate, Non-denatured, Abnova
Non-denatured whole cell lysate of A-549 (human lung carcinoma)
MCF-7(human breast adenocarcinoma) Whole cell lysate, Non-denatured; Abnova
Non-denatured whole cell lysate of MCF-7(human breast adenocarcinoma)