Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502108592

CPC Scientific H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH 0.5MG
SDP

Supplier:  CPC Scientific ACTH001A

Encompass

Pituitary hormone N-terminal synthetic fragment that stimulates glucocorticoid and mineralocorticoid synthesis and release in the adrenal cortex.SEQUENCE: H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OHONE-LETTER SEQUENCE: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEFMOLECULAR FORMULA: C207H308N56O58S1MOLECULAR WEIGHT: 4541.2STORAGE CONDITIONS: -20 5 CCAS REGISTRY NUMBER: [12279-41-3]SYNONYMS: Adrenocorticotropic HormoneRESEARCH AREA: HormonalREFERENCES:D. Yamashiro et al, JACS, 95, 1310 (1973)N.Y. Ann. Acad. Sci., 297,1-641 (1977)SKU(s): ACTH-001A, ACTH-001B

Catalog No. 50-210-8592


May include imposed supplier surcharges.
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.