Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502108624

CPC Scientific H-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (trifluoroacetate salt) 1MG
SDP

Supplier:  CPC Scientific ADRM005B

Encompass

Adrenomedullin-elicted cAMP antagonist and a more effective inhibitor than alpha-CGRP in terms of adrenomedullin- and CGRP-specific receptors.ONE-LETTER SEQUENCE: TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2MOLECULAR FORMULA: C159H252N46O48MOLECULAR WEIGHT:3576.1STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [159899-65-7], RESEARCH AREA: Cardiovascular

Catalog No. 50-210-8624


May include imposed supplier surcharges.
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.