Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CPC Scientific H-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (trifluoroacetate salt) 0.5MG
SDP

Supplier:  CPC Scientific ADRM010A

Encompass

C-terminal fragment found to induce dose-dependent and endothelium-independent vasodilatation on arterial mesenteric vasculator, though inactive on the venous side of tested rat perfused mesentric bed. This peptide thus shares similar properties to those of CGRP (human)ONE-LETTER SEQUENCE: STGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (Cys4 and 9 bridge)MOLECULAR FORMULA: C194H304N58O59S4MOLECULAR WEIGHT:4521.17STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [163648-32-6], SYNONYMS: Adrenomedullin (11-50) (rat)RESEARCH AREA: CardiovascularREFERENCES: N.Berthiaume et al., Can. J. Physiol. Pharmacol., 73, 1080 (1995); A.M.Elhawary et al., Br. J. Pharmacol., 115, 1133 (1995)

Catalog No. 50-210-8633


May include imposed supplier surcharges.
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.