Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 5000425206

Medchemexpress LLC Amylin, amide, human | 122384-88-7 | >98.3% | 3903.28 | 500 UG
SDP

Catalog No. 5000425206
Encompass_Preferred

Amylin, amide, human is a 37-amino acid polypeptide, a pancreatic hormone cosecreted with insulin. It plays crucial roles in metabolism and glucose homeostasis, inhibiting glucagon secretion, delaying gastric emptying, and acting as a satiety agent.

  • Appearance: Solid
  • Color: White to off-white
  • Chemical formula: C165H261N51O55S2
  • Sequence shortening: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 (Disulfide bridge: Cys2-Cys7)
  • Inhibits glucagon secretion
  • Delays gastric emptying
  • Acts as a satiety agent

Catalog No. 50-004-25206 Supplier Medchemexpress LLC Supplier No. HYP1070A500UG
May include imposed supplier surcharges.
Add to Cart
Add to Cart

missing translation for 'validMainframeMsg'

Amylin, amide, human is a 37-amino acid polypeptide, a pancreatic hormone cosecreted with insulin. It plays crucial roles in metabolism and glucose homeostasis, inhibiting glucagon secretion, delaying gastric emptying, and acting as a satiety agent.

  • Appearance: Solid
  • Color: White to off-white
  • Chemical formula: C165H261N51O55S2
  • Sequence shortening: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 (Disulfide bridge: Cys2-Cys7)
  • Inhibits glucagon secretion
  • Delays gastric emptying
  • Acts as a satiety agent

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.