Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502108757

CPC Scientific H-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Ala-Ile-Leu-Ser-Ser-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-OH (trifluoroacetate salt) 1MG
SDP

Supplier:  CPC Scientific AMYN003B

Encompass

Amylin (8-37) is a truncated analog of native Amylin that selectively inhibits insulin-related glucose uptake and glycogen deposition in muscle tissue. The peptide has a systemic increase in insulin sensitivity and has shown to reduce basal insulin levels in both normal and hGH-induced insulin-resistant rats.ONE-LETTER SEQUENCE: ATQRLANFLVHSSNNFGAILSSTNVGSNTYMOLECULAR FORMULA: C138H215N41O46MOLECULAR WEIGHT:3184.45STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [135702-23-7], SYNONYMS: Amylin (8-37) (human)RESEARCH AREA: DiabetesREFERENCES: Deems, R.O. et al. Biochem. Biophys. Res. Commun., 181, 116 (1991); Kaygisiz, Z. et al. Acta Physiol. Hung. 90, 133 (2003); B.Konarkowska et al., FEBS J., 272, 4949 (2005)

Catalog No. 50-210-8757


May include imposed supplier surcharges.
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.