Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502108759

CPC Scientific H-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (trifluoroacetate salt) 1MG
SDP

Supplier:  CPC Scientific AMYN005B

Encompass

An amylin receptor antagonist that attenuates the ANP release in streptozotocin-treated rats.ONE-LETTER SEQUENCE: ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2MOLECULAR FORMULA: C140H227N43O43MOLECULAR WEIGHT:3200.6STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [135702-23-7], RESEARCH AREA: DiabetesREFERENCES: R.O. Deems et al., BBRC, 181, 116 (1991)

Catalog No. 50-210-8759


May include imposed supplier surcharges.
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.