Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 50850244

AnaSpec AMYLOID (1-40) N-TERMINAL

Catalog No. 50850244
Encompass

Beta-Amyloid (1-40), Human[DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV] ; MW 4329.9; (0.5 mg) AB (1-40) together with AB (1-42) are two major C-terminal variants of the AB protein constituting the majority of ABs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain.

Catalog No. 50-850-244 Supplier AnaSpec Supplier No. AS24235
May include imposed supplier surcharges.
Add to Cart
Add to Cart

missing translation for 'validMainframeMsg'

Beta-Amyloid (1-40), Human[DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV] ; MW 4329.9; (0.5 mg) AB (1-40) together with AB (1-42) are two major C-terminal variants of the AB protein constituting the majority of ABs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain.

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.