Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AnaSpec AMYLOID (1-40) N-TERMINAL
Supplier: AnaSpec AS24235
Beta-Amyloid (1-40), Human[DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV] ; MW 4329.9; (0.5 mg) AB (1-40) together with AB (1-42) are two major C-terminal variants of the AB protein constituting the majority of ABs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain.
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?