Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 5000398108

Medchemexpress LLC β Amyloid (1-42) (scrambled) TFA | 99.8% | 4514.04 (free base) | 5 MG
SDP

Catalog No. 5000398108
Encompass_Preferred

β Amyloid (1-42) (scrambled) TFA serves as a negative control for β-Amyloid (1-42) human TFA (HY-P1363).

  • Targets Amyloid-ß.
  • Involved in Neuronal Signaling pathway.
  • Appears as a white to off-white solid.
  • Purity by HPLC is 99.8%.
  • Molecular weight is 4514.04 (free base).
  • Sequence shortening: AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA.
  • Powder can be stored at -80°C for 2 years or -20°C for 1 year.
  • When in solvent, store at -80°C for 6 months or -20°C for 1 month.
  • In vitro solubility in DMSO is 25 mg/mL (ultrasonic needed).

Catalog No. 50-003-98108 Supplier Medchemexpress LLC Supplier No. HYP4867A5MG
May include imposed supplier surcharges.
Add to Cart
Add to Cart

missing translation for 'validMainframeMsg'

β Amyloid (1-42) (scrambled) TFA serves as a negative control for β-Amyloid (1-42) human TFA (HY-P1363).

  • Targets Amyloid-ß.
  • Involved in Neuronal Signaling pathway.
  • Appears as a white to off-white solid.
  • Purity by HPLC is 99.8%.
  • Molecular weight is 4514.04 (free base).
  • Sequence shortening: AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA.
  • Powder can be stored at -80°C for 2 years or -20°C for 1 year.
  • When in solvent, store at -80°C for 6 months or -20°C for 1 month.
  • In vitro solubility in DMSO is 25 mg/mL (ultrasonic needed).

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.