Learn More
CPC Scientific H-Ala-Ala-Val-Thr-Pro-Glu-Glu-Arg-His-Leu-Ser-Lys-Met-Gln-Gln-Asn-Gly-Tyr-Glu-Asn-Pro-Thr-Tyr-Lys-Phe-Phe-Glu-Gln-Met-Gln-Asn-OH (trifluoroacetate salt) 1MG

Supplier: CPC Scientific AMYD049A
This peptide is the C-terminal fragment of amyloid precursor protein (APP) also known as C31. It is intracellularly generated by proteolytic cleavage of APP by caspases-8 and -9. C31 had a proapoptotic and a cytotoxic effect on neuronal cells and was shown to be present in brains of Alzheimer's disease (AD) patients. In cultured cells caspase cleavage of APP was induced by amyloid beta-protein and the subsequent generation of C31 contributed to the apoptotic cell death associated with amyloid beta-protein. Amyloid precursor binding protein BP1 (APP-BP1) a cell cycle protein which is increased in AD brain was demonstrated to bind to the C31 region of APP and to mediate APP-induced apoptosis.ONE-LETTER SEQUENCE: AAVTPEERHLSKMQQNGYENPTYKFFEQMQNMOLECULAR FORMULA: C162H243N45O52S2MOLECULAR WEIGHT:3717.12STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [1802086-24-3], RESEARCH AREA: Alzheimer's DiseaseREFERENCES: D.C.Lu et al., Nat. Med., 6, 397 (2000); C.Dumanchin-Njock et al., J
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.