Novus Biologicals™ ATP2C2 Recombinant Protein Antigen

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATP2C2. Source: E.coli Amino Acid Sequence: WMAVKCSLKTEDQEDIYFMKGALEEVIRYCTMYNNGGIPLPLTPQQRSFCLQEEKRM The ATP2C2 Recombinant Protein Antigen is derived from E. coli. The ATP2C2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 9914
• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Common Name: ATP2C2 Recombinant Protein Antigen
• Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
• Formulation: PBS and 1M Urea, pH 7.4.
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: ATPase 2C2, ATPase, Ca++ transporting, type 2C, member 2, calcium-transporting ATPase type 2C member 2, DKFZp686H22230, KIAA0703, secretory pathway Ca(2+)-ATPase 2, secretory pathway calcium ATPase 2, SPCA2
• Gene Symbol: ATP2C2
• Label Type: Unlabeled
• Product Type: Recombinant Protein Antigen
• Quantity: 100 μL
• Regulatory Status: RUO
• Source: E.coli
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53548. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For Research Use Only.