Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ BAHCC1 Recombinant Protein Antigen
SDP

Catalog No. NP269028PEP Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NP269028PEP 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NP269028PEP Supplier Novus Biologicals™ Supplier No. NBP269028PEP
Only null left
Add to Cart
Add to Cart

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BAHCC1

Source: E.coli

Amino Acid Sequence:

SGLDKSGYFELPTSSQDCARPGHQDPLGGKAPQACCTLDKTVGKEAPAGPPGAQKVARIRHQQHLMAAEVEQGGIGAEAKRKSLELA

Specifications

Gene ID (Entrez) 57597
Purity >80% by SDS-PAGE and Coomassie blue staining
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4.
For Use With (Application) Antibody Competition
Gene Alias BAH and coiled-coil domain-containing protein 1, BAH domain and coiled-coil containing 1, BAH domain-containing protein 2, BAHD2, bromo adjacent homology domain-containing protein 2, FLJ23058, KIAA1447
Gene Symbol BAHCC1
Molecular Weight (g/mol) 27 kDa
Quantity 100 μL
Source E. coli
Specific Reactivity This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55048. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Storage Buffer PBS and 1M Urea, pH 7.4.
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.