Learn More
CPC Scientific H-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH (trifluoroacetate salt) 1MG

Supplier: CPC Scientific AMYD017B
ONE-LETTER SEQUENCE: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIAMOLECULAR FORMULA: C199H307N53O59S1MOLECULAR WEIGHT:4418STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [107761-42-2], RESEARCH AREA: Alzheimer's DiseaseREFERENCES: E. Paradis et al., J. Neurosci., 16, 7533 (1996); J. Murrell et al., Science, 254, 97 (1991); D. Goldgabber et al., Science, 235, 877 (1987)
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.