Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CPC Scientific H-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH (trifluoroacetate salt) 1MG
SDP

Supplier:  CPC Scientific AMYD017B

Encompass

ONE-LETTER SEQUENCE: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIAMOLECULAR FORMULA: C199H307N53O59S1MOLECULAR WEIGHT:4418STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [107761-42-2], RESEARCH AREA: Alzheimer's DiseaseREFERENCES: E. Paradis et al., J. Neurosci., 16, 7533 (1996); J. Murrell et al., Science, 254, 97 (1991); D. Goldgabber et al., Science, 235, 877 (1987)

Catalog No. 50-210-8669


May include imposed supplier surcharges.
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.