Learn More
CPC Scientific H-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH (trifluoroacetate salt) 0.5MG

Supplier: CPC Scientific AMYD018A
ONE-LETTER SEQUENCE: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVMOLECULAR FORMULA: C190H291N51O57S1MOLECULAR WEIGHT:4233.8STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [131438-79-4], RESEARCH AREA: Alzheimer's DiseaseREFERENCES: A. Klegeris et al., Biochem. Biophys. Res. Commun., 199, 984 (1994); M.A.Kowalska et al., Biochem. Biophys. Res. Commun., 205, 1829 (1994); B.A. Yankner et al., Science, 250, 279 (1990)
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.