Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CPC Scientific H-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe-OH (trifluoroacetate salt) 1MG
SDP

Catalog No. 502109865
Encompass

Brain natriuretic peptide or B-type natriuretic peptide (BNP) (also ventricular natriuretic peptide) is a 32-amino acid peptide secreted by heart ventricles in response to excessive stretching of heart muscle cells (cardiomyocytes).ONE-LETTER SEQUENCE: NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Cys10 and 26 bridge)MOLECULAR FORMULA: C146H239N47O44S3MOLECULAR WEIGHT:3453STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [133448-20-1], RESEARCH AREA: CardiovascularREFERENCES: M. Kojima et al., BBRC, 159, 1420 (1989)

Catalog No. 50-210-9865 Supplier CPC Scientific Supplier No. NATR013B
May include imposed supplier surcharges.
Add to Cart
Add to Cart

missing translation for 'validMainframeMsg'

Brain natriuretic peptide or B-type natriuretic peptide (BNP) (also ventricular natriuretic peptide) is a 32-amino acid peptide secreted by heart ventricles in response to excessive stretching of heart muscle cells (cardiomyocytes).ONE-LETTER SEQUENCE: NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Cys10 and 26 bridge)MOLECULAR FORMULA: C146H239N47O44S3MOLECULAR WEIGHT:3453STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [133448-20-1], RESEARCH AREA: CardiovascularREFERENCES: M. Kojima et al., BBRC, 159, 1420 (1989)

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.