Learn More
Kingfisher Biotech Inc Bovine IL-17A Recombinant Protein (Yeast, Endotoxin - Free) - 5 ug

Supplier: Kingfisher Biotech Inc RP0056B005
The Bovine IL-17A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-17A applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine IL-17A yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-17A Specifications: (Molecular Weight: 15.0 kDa) (Amino Acid Sequence: (KAGVIIPQSPGCPPTEDKNFPQHVRVNLNIVNRSTNSRRPTDYHKRSTSPWTLHRNEDPERYPSVIWEAKCSHSGCINAEGKVDHHMNSVTIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIVRHLA) (Gene ID: 282863). For research use only. Made in the USA
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.