Novus Biologicals™ BRAP Recombinant Protein Antigen

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BRAP. Source: E.coli Amino Acid Sequence: STPNQYMVLIKFRAQADADSFYMTCNGRQFNSIEDDVCQLVYVERAEVLKSEDGASLPVMDLTELPKCTVCLERMDESVNGILTTLCNHSFHSQC The BRAP Recombinant Protein Antigen is derived from E. coli. The BRAP Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 8315
• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Common Name: BRAP Recombinant Protein Antigen
• Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
• Formulation: PBS and 1M Urea, pH 7.4.
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: BRAP2RING finger protein 52, BRCA1 associated protein, EC 6.3.2.-, IMPBRCA1-associated protein, Impedes mitogenic signal propagation, Renal carcinoma antigen NY-REN-63, RNF52galectin-2-binding protein
• Gene Symbol: BRAP
• Label Type: Unlabeled
• Product Type: Recombinant Protein Antigen
• Quantity: 100 μL
• Regulatory Status: RUO
• Source: E.Coli
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52305. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For Research Use Only