Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Protein Analysis Reagents
  4. Protein Purification
  5. Protease Inhibitors and Phosphatase Inhibitors
  6. 5087610001

MilliporeSigma™ Calbiochem™ PCSK9 Inhibitor, EGF-A

Catalog No. 5087610001 Shop All MilliporeSigma Products
Click to view available options
Quantity:
1 mg

Description

A 42-mer synthetic peptide (GTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDI-NH2) that contains a calcium binding site of EGF-A

A 42-mer synthetic peptide (GTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDI-NH2) that contains a calcium binding site of EGF-A. Binds to the proprotein convertase subtilisin/kexin type 9 (PCSK9) in a pH and calcium-dependent manner (Kd = 300nM at pH 5.2 and 1.0μM at pH7.4 and at 2mm calcium) and blocks its interaction with LDL receptors (IC50 = 3.4μM) and VLDL receptors (IC50 = 4.7μM). Acts as a poor inhibitor of PCSK9 - Apo-ER2 interaction even at high concentrations (∽200μM). Blocks the degradation of mature LDL receptors in HepG2 cells in a dose-dependent manner (∽1.5 to 15μM).

Please note that the molecular weight for this compound is batch-specific due to variable water content.
TRUSTED_SUSTAINABILITY

Specifications

Color White
Description 95% by HPLC
Target Proteins PCSK9
Molecular Formula C188H292N58O65S6
Solubility H2O
Content And Storage Hygroscopic, Protect from light
Form Powder
Quantity 1 mg
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.