Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MilliporeSigma™ Calbiochem™ SNX-482

Catalog No. 5085120001 Shop All MilliporeSigma Products
Change view
Click to view available options
Quantity:
10 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
50-851-20001 10 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 50-851-20001 Supplier MilliporeSigma™ Supplier No. 5085120001
Only null left
Add to Cart
Add to Cart

A peptidyl toxin from venom of African tarantula, Hysterocrates gigas that acts as a high affinity, reversible blocker of Cav2.3 (α1E, R-type) channels (IC50 = 15-30 nM).

  • Peptide Sequence: GVDKAGCRYMFGGCSVNDDCCPRLGCHSLF?SYCAWDLTFSD (difulfid bond: 7-21, 14-26, 20-33)
  • Deactivate with 5% Bleach
TRUSTED_SUSTAINABILITY

Specifications

Color White
Description 98% by HPLC
Target Proteins Cav2.3 channels
Molecular Formula C192H274N52O60S7
Formula Weight 4495.01g/mol
Solubility H2O
Content And Storage Protect from light
Form Solid
Quantity 10 μg
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.