Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Protein Analysis Reagents
  4. Protein Purification
  5. Protease Inhibitors and Phosphatase Inhibitors
  6. 5085120001

MilliporeSigma™ Calbiochem™ SNX-482

Catalog No. 5085120001
Click to view available options
Quantity:
10 μg

Description

A peptidyl toxin from venom of African tarantula, Hysterocrates gigas that acts as a high affinity, reversible blocker of Cav2.3 (α1E, R-type) channels (IC50 = 15-30 nM).

  • Peptide Sequence: GVDKAGCRYMFGGCSVNDDCCPRLGCHSLF?SYCAWDLTFSD (difulfid bond: 7-21, 14-26, 20-33)
  • Deactivate with 5% Bleach
TRUSTED_SUSTAINABILITY

Specifications

Color White
Description 98% by HPLC
Target Proteins Cav2.3 channels
Molecular Formula C192H274N52O60S7
Formula Weight 4495.01g/mol
Solubility H2O
Content And Storage Protect from light
Form Solid
Quantity 10 μg
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.