Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

enQuire Bioreagents Calponin-1 Anti-Human Monoclonal [Clone SPM169], Size: 100ug

Supplier:  enQuire Bioreagents 55107MSM3P1

Encompass_Preferred

Product Type: Antibody. Application: Flow, IF, IHC. Conjugate/Tag: Unconjugated. Clone: DG1/447 + DOG-1.1. Clonality: Monoclonal. Host: Mouse. Isotype: IgG. Positive Control: Gastrointestinal Stromal Tumor (GIST) or testicular germ cell tumor. Melanocytes in the basal layer of the epidermis, mast cells in the dermis of normal skin. Cellular Staining: Cell Surface, Cytoplasm. Buffer: 10mM PBS with 0.05% BSA & 0.05% azide. Concentration: 200ug/ml. Purity: Protein A/G Purified. Immunogen: Recombinant human DOG-1 protein (DG1/447) + A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated . Storage: Short term: Store at 2-4C. Long term, aliquot and store at -20C. MW: 114kDa.Chromosome: 11q13.3. Gene Symbol: TMEM16A. Gene ID: 55107. Ensemble: ENSG00000131620. Uniprot: NP_011543428.

Catalog No. 50-188-5077


May include imposed supplier surcharges.
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.