Learn More
enQuire Bioreagents Calponin-1 Anti-Human Monoclonal [Clone SPM169], Size: 100ug
Supplier: enQuire Bioreagents 55107MSM2P1
Product Type: Antibody. Application: Flow, IF, IHC. Conjugate/Tag: Unconjugated. Clone: DOG-1.1. Clonality: Monoclonal. Host: Mouse. Isotype: IgG1 kappa. Positive Control: Gastrointestinal Stromal Tumor (GIST) or testicular germ cell tumor. Melanocytes in the basal layer of the epidermis, mast cells in the dermis of normal skin. Cellular Staining: Cell Surface, Cytoplasm. Buffer: 10mM PBS with 0.05% BSA & 0.05% azide. Concentration: 200ug/ml. Purity: Protein A/G Purified. Immunogen: A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQL-LETCMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein. Storage: Short term: Store at 2-4C. Long term, aliquot and store at -20C. MW: 114kDa.Chromosome: 11q13.3. Gene Symbol: TMEM16A. Gene ID: 55107. Ensemble: ENSG00000131620. Uniprot: NP_011543428.
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.