Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502108925

CPC Scientific H-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu-OH (trifluoroacetate salt) 0.5MG
SDP

Supplier:  CPC Scientific CART005A

Encompass

SEQUENCE: H-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu-OH (trifluoroacetate salt)(Cys13 and 33 bridge, Cys7 and 25 bridge, Cys27 and 40 bridge)ONE-LETTER SEQUENCE: YGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL (Cys13 and 33 bridge, Cys7 and 25 bridge, Cys27 and 40 bridge)MOLECULAR FORMULA: C183H298N56O55S7MOLECULAR WEIGHT: 4387.25STORAGE CONDITIONS: -20 5 CCAS REGISTRY NUMBER: [209615-79-2]SYNONYMS: RESEARCH AREA: ObesityREFERENCES:Thim, Lars, et al. FEBS Letters 428.3 (1998): 263-268.SKU(s): CART-005A, CART-005B

Catalog No. 50-210-8925


May include imposed supplier surcharges.
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.