Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CPC Scientific H-Ile-Pro-Ile-Tyr-Glu-Lys-Lys-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu-OH (trifluoroacetate salt) 0.5MG
SDP

Catalog No. 502108919
Encompass

SEQUENCE: H-Ile-Pro-Ile-Tyr-Glu-Lys-Lys-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu-OH (trifluoroacetate salt)(Cys20 and 40, Cys14 and 32, Cys34 and 47)ONE-LETTER SEQUENCE: IPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL (Cys20 and 40 bridge, Cys14 and 32 bridge, Cys34 and 47 bridge)MOLECULAR FORMULA: C226H367N65O65S7MOLECULAR WEIGHT: 5259.34STORAGE CONDITIONS: -20 5 CCAS REGISTRY NUMBER: [209615-79-2]SYNONYMS: CART (55-102) (rat)RESEARCH AREA: ObesityREFERENCES:SKU(s): CART-002A, CART-002B

Catalog No. 50-210-8919 Supplier CPC Scientific Supplier No. CART002A
May include imposed supplier surcharges.
Add to Cart
Add to Cart

missing translation for 'validMainframeMsg'

SEQUENCE: H-Ile-Pro-Ile-Tyr-Glu-Lys-Lys-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu-OH (trifluoroacetate salt)(Cys20 and 40, Cys14 and 32, Cys34 and 47)ONE-LETTER SEQUENCE: IPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL (Cys20 and 40 bridge, Cys14 and 32 bridge, Cys34 and 47 bridge)MOLECULAR FORMULA: C226H367N65O65S7MOLECULAR WEIGHT: 5259.34STORAGE CONDITIONS: -20 5 CCAS REGISTRY NUMBER: [209615-79-2]SYNONYMS: CART (55-102) (rat)RESEARCH AREA: ObesityREFERENCES:SKU(s): CART-002A, CART-002B

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.