Novus Biologicals™ CCL19/MIP-3 beta Recombinant Protein Antigen

Catalog No.	Quantity
NBP256275PE	100 μL

Catalog No. NBP256275PE Supplier Novus Biologicals™ Supplier No. NBP256275PEP

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CCL19/MIP-3 beta. Source: E.coli Amino Acid Sequence: LLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS The CCL19/MIP-3 beta Recombinant Protein Antigen is derived from E. coli. The CCL19/MIP-3 beta Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 6363
• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Common Name: CCL19/MIP-3 beta Recombinant Protein Antigen
• Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
• Formulation: PBS and 1M Urea, pH 7.4.
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: beta chemokine exodus-3, Beta-chemokine exodus-3, CC chemokine ligand 19, C-C motif chemokine 19, chemokine (C-C motif) ligand 19, CKb11, EBI1-ligand chemokine, ELCMIP-3-beta, Epstein-Barr virus-induced molecule 1 ligand chemokine, exodus-3, Macrophage in
• Gene Symbol: CCL19
• Label Type: Unlabeled
• Product Type: Recombinant Protein Antigen
• Quantity: 100 μL
• Regulatory Status: RUO
• Source: E.Coli
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53052. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For Research Use Only.