Novus Biologicals™ CD117/c-kit Recombinant Protein Antigen

Catalog No.	Quantity
NBP257890PE	100 μL

Catalog No. NBP257890PE Supplier Novus Biologicals™ Supplier No. NBP257890PEP

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD117/c-kit. Source: E.coli Amino Acid Sequence: RKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNEYMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELAL The CD117/c-kit Recombinant Protein Antigen is derived from E. coli. The CD117/c-kit Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 3815
• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Common Name: CD117/c-kit Recombinant Protein Antigen
• Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
• Formulation: PBS and 1M Urea, pH 7.4
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: CD117, CD117 antigen, ckit, C-Kit, EC 2.7.10, EC 2.7.10.1, PBT, piebald trait, Proto-oncogene c-Kit, proto-oncogene tyrosine-protein kinase Kit, SCFRmast/stem cell growth factor receptor, soluble KIT variant 1, Tyrosine-protein kinase Kit, v-kit Hardy-Zuc
• Gene Symbol: KIT
• Label Type: Unlabeled
• Product Type: Recombinant Protein Antigen
• Quantity: 100 μL
• Regulatory Status: RUO
• Source: E.coli
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53402. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For research use only.