Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502109128

CPC Scientific H-Met-Cys-Met-Pro-Cys-Phe-Thr-Thr-Asp-His-Gln-Met-Ala-Arg-Lys-Cys-Asp-Asp-Cys-Cys-Gly-Gly-Lys-Gly-Arg-Gly-Lys-Cys-Tyr-Gly-Pro-Gln-Cys-Leu-Cys-Arg-NH2 (trifluoroacetate salt)
(Disulfide Bridge: Cys1-Cys4,Cys2-Cys6,Cys3-Cys7,Cys5-Cys8) 0.5MG
SDP

Supplier:  CPC Scientific CLTX001B

Encompass

Chlorotoxin is a chloride channel blocker originally isolate from the venom of the deathstalker scorpion. This 36-mer peptide also selectively binds to glioma cells which has made it a candiate for cancer therapeutics.SEQUENCE: H-Met-Cys-Met-Pro-Cys-Phe-Thr-Thr-Asp-His-Gln-Met-Ala-Arg-Lys-Cys-Asp-Asp-Cys-Cys-Gly-Gly-Lys-Gly-Arg-Gly-Lys-Cys-Tyr-Gly-Pro-Gln-Cys-Leu-Cys-Arg-NH2 (trifluoroacetate salt)(Disulfide Bridge: Cys1-Cys4,Cys2-Cys6,Cys3-Cys7,Cys5-Cys8)ONE-LETTER SEQUENCE: MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2MOLECULAR FORMULA: C158H249N53O47S11MOLECULAR WEIGHT: 3995.77STORAGE CONDITIONS: -20 5 CCAS REGISTRY NUMBER: [163515-35-3]SYNONYMS: RESEARCH AREA: ToxinREFERENCES:DeBin JA, Strichartz GR. Toxicon 29 (11): 1403, 8, (1991).Deshane J, Garner CC, Sontheimer H . J. Biol. Chem. 278 (6): 4135, 44, (2003).SKU(s): CLTX-001A, CLTX-001B

Catalog No. 50-210-9128


May include imposed supplier surcharges.
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.