Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Abnova™ CNIH3 Recombinant Protein
$503.00 - $775.00
Specifications
Accession Number | AAH22780 |
---|---|
For Use With (Application) | Antibody Production, Protein Array, ELISA, Western Blot |
Formulation | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
Gene ID (Entrez) | 149111 |
Molecular Weight (g/mol) | 43.34 |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
89-013-900
|
Abnova™
H00149111P0110 |
10 ug |
Each for $503.00
|
|
|||||
89-013-901
|
Abnova™
H00149111P0125 |
25 ug |
Each for $775.00
|
|
|||||
Description
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifications
AAH22780 | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
43.34 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
Wheat Germ (in vitro) | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
CNIH3 | |
Human | |
Recombinant | |
Solution |
Antibody Production, Protein Array, ELISA, Western Blot | |
149111 | |
CNIH3 (Human) Recombinant Protein (P01) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MAFTFAAFCYMLSLVLCAALIFFAIWHIIAFDELRTDFKSPIDQCNPVHARERLRNIERICFLLRKLVLPEYSIHSLFCIMFLCAQEWLTLGLNVPLLFYHFWRYFHCPADSSELAYDPPVVMNADTLSYCQKEAWCKLAFYLLSFFYYLYCMIYTLVSS | |
FLJ38993 | |
CNIH3 | |
Wheat Germ (in vitro) | |
GST |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title