Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502109135

CPC Scientific H-Ala-Ser-Asp-Arg-Ser-Asn-Ala-Thr-Gln-Leu-Asp-Gly-Pro-Ala-Gly-Ala-Leu-Leu-Leu-Arg-Leu-Val-Gln-Leu-Ala-Gly-Ala-Pro-Glu-Pro-Phe-Glu-Pro-Ala-Gln-Pro-Asp-Ala-Tyr-OH (trifluoroacetate salt) 0.5MG
SDP

Supplier:  CPC Scientific COPE001A

Encompass

This peptide derived from the vasopressin-neurophysin 2-copeptin precursor, a prognostic marker in a variety of diseases, such as sepsis, community-acquired pneumonia, chronic obstructive pulmonary failure, heart failure and myocardial infarction.ONE-LETTER SEQUENCE: ASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAYMOLECULAR FORMULA: C177H279N49O58MOLECULAR WEIGHT:4021.46STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [78362-34-2], RESEARCH AREA: CardiovascularREFERENCES: J.Struck et al., Peptides, 26, 2500 (2005); N.G.Morgenthaler et al., Clin. Chem., 52, 112 (2006); S.Q.Khan et al., Circulation, 115, 2103 (2007); G.Szinnai et al., J. Clin. Endocrinol. Metab., 92, 3973 (2007); M.Katan et al., Crit. Care, 12, 117 (2008); R.Seligman et al., Crit. Care, 12, R11 (2008)

Catalog No. 50-210-9135


May include imposed supplier surcharges.
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.