Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. 66991

Tocris Bioscience™ [D-Ala2]-GIP (human)
GREENER_CHOICE

Catalog No. 66991
Click to view available options
Quantity:
1 mg
This item is not returnable. View return policy
This item is not returnable. View return policy

Description

Highly potent GIP agonist

[D-Ala2]-GIP (human) is a highly potent GIP receptor agonist (EC50 = 630 ± 119 pM). Displays equivalent cAMP stimulating properties and improved resistance to enzymatic degradation compared to native GIP (Cat. No. 2084) in cells expressing wild type GIP receptor. Improves glucose tolerance, insulin release and cognitive function in various animal models of obesity and diabetes. Displays neuroprotective effects in an MPTP model of PD.

Specifications

Purity 95%
CAS 444073-04-5
Content And Storage Store at -20°C
Description GIP receptor agonist
Formulation C226H338N60O66S
Molecular Weight (g/mol) 4983.58
Quantity 1 mg
Sequence YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ (Modifications: Ala-2 = D-Ala)
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.