Novus Biologicals™ DDX18 Recombinant Protein Antigen

Catalog No.	Quantity
NBP258939PE	100μL

Catalog No. NBP258939PE Supplier Novus Biologicals™ Supplier No. NBP258939PEP

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DDX18. Source: E.coli Amino Acid Sequence: ETMGSRKVKKSKQKPMNVGLSETQNGGMSQEAVGNIKVTKSPQKSTVLTNGEAAMQSSNSES The DDX18 Recombinant Protein Antigen is derived from E. coli. The DDX18 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 8886
• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Common Name: DDX18 Recombinant Protein Antigen
• Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
• Formulation: PBS and 1M Urea, pH 7.4.
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: DEAD (Asp-Glu-Ala-Asp) box polypeptide 18, DEAD box protein 18, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 18 (Myc-regulated), EC 3.6.1, EC 3.6.4.13, FLJ33908, MrDbATP-dependent RNA helicase DDX18, Myc-regulated DEAD box protein
• Gene Symbol: DDX18
• Label Type: Unlabeled
• Product Type: Recombinant Protein Antigen
• Quantity: 100μL
• Regulatory Status: RUO
• Source: E.coli
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51377. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For Research Use Only.